KEGG   Schizophyllum commune: SCHCODRAFT_56489Help
Entry
SCHCODRAFT_56489  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K13941  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
scm  Schizophyllum commune
Pathway
scm00790  Folate biosynthesis
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCHCODRAFT_56489
Enzymes [BR:scm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SCHCODRAFT_56489
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SCHCODRAFT_56489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_bind HPPK
Motif
Other DBs
NCBI-GeneID: 9586724
NCBI-ProteinID: XP_003030977
JGI: Schco1_56489
UniProt: D8Q7S5
Position
Unknown
AA seq 498 aa AA seqDB search
IHRAAIALGANIGDKFHNIEYALRLLEAAPRLGVDLEVEAPVVDIVDTSFLYESAPMYVT
DQPSFINCACMIETNVPPVALLRLLKKIEEIVGRVPSVRNGPRAIDLDVVFYDDEVIDTR
PPEDQGSLDNLQGHLVVPHPRLHERDFVLRPLADMIPDYVHPSFCKSISRMYGIAPVPET
LTSWTYTPANPGRDAMLMATLNVTPDSFSDGAEHSQLSDALAYVDESVSAGASIIDIGGY
STRPGAAYVSPEEEAQRVVPVVQAIRAKDGPARDIPISVDTFRPDVAEAAIRAGANCIND
VYAFMGADAYPFDDVGHKAKSDAVLVSMKDIARRYAVPVVLMHSRGEAGKNKDYSAYAYA
GEGAETVEGVRVELGDIVERVVRGKGGVRRWLVIVDPGVGFSKTVQGNLALLRDGAQVVA
DRRRNPLAGYPVLVGTSRKSFLGSILEAGINARRTEGRERDWATAAAITCAVQQGALLIR
AHDVQRMADVITVAKALT
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atccaccgggcagccatcgctctaggcgctaatatcggggacaagttccacaacattgag
tatgccctgcgcttgctggaggctgcgccccgccttggtgtagaccttgaagtggaggca
ccggtggtagacatcgtggacaccagcttcctgtacgagtcggcgccgatgtacgtgacg
gaccaaccgtctttcatcaactgcgcgtgcatgatcgagaccaatgtgccgcctgttgct
ctccttcgtttactcaaaaagatcgaggagattgttggccgcgtaccctccgtgcgcaac
ggcccgcgagccatcgacctcgacgtcgtcttctacgacgacgaagtcatcgacaccagg
ccacccgaagaccagggctcgctcgacaacttgcagggacatcttgtcgtaccccatccg
cggctgcacgagagggactttgtgcttcgcccgctggccgacatgatccccgactacgtc
catccctctttctgcaagtccatctcgcgcatgtacggtatagccccagtcccagaaacc
ctcacatcttggacgtacaccccggcgaaccctgggcgtgatgctatgctcatggctacg
ctcaacgtcacaccagactccttctccgacggcgcagagcacagccagctctccgatgcc
cttgcatacgtcgacgagtccgtctccgccggtgccagcatcatcgacattggcggttac
tctacgcgcccgggcgccgcctacgtgtcgccggaggaagaggcccagcgcgtcgtgccg
gtggtacaggccataagagccaaggacggtccggcgcgggacatacccatcagcgtcgat
accttccgcccagacgtcgctgaggcagccatccgggccggcgcgaactgcatcaacgat
gtctacgcgttcatgggcgccgacgcatatcccttcgatgatgtggggcacaaagcgaag
tcagatgctgtcctcgtcagcatgaaggatatcgcaagacgctacgccgtgcctgtagtg
ctgatgcactcgcggggcgaggcgggcaagaacaaggattacagcgcgtatgcgtatgcg
ggggaaggagcagagactgtcgagggagtgcgggtggagctcggggacatcgtcgaacgg
gtcgttcggggcaagggaggcgttcgcaggtggcttgtcatcgtcgaccccggtgtaggc
ttcagcaagactgtccaaggcaatcttgcgctgctgagggatggcgcgcaggtcgtagcc
gatcgacgtcgaaatcctctagcgggataccctgtcctcgtcggcacgtcgcgcaagtcg
ttcctcggatcgattcttgaagccggaatcaacgctaggagaacggaggggagggagagg
gattgggcgacggctgcagcgatcacatgcgccgttcagcagggtgcgctcttgattcgt
gcgcacgatgtacagaggatggcggatgtgatcacagtggcgaaggcgctaacctga

DBGET integrated database retrieval system