KEGG   Schizophyllum commune: SCHCODRAFT_57501Help
Entry
SCHCODRAFT_57501  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K11227  mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
scm  Schizophyllum commune
Pathway
scm04011  MAPK signaling pathway - yeast
scm04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:scm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SCHCODRAFT_57501
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    SCHCODRAFT_57501
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     SCHCODRAFT_57501
Protein kinases [BR:scm01001]
 Serine/threonine kinases: STE group
  STE7 family
   SCHCODRAFT_57501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 9591434
NCBI-ProteinID: XP_003030014
JGI: Schco1_57501
UniProt: D8Q8S5
Position
Unknown
AA seq 304 aa AA seqDB search
MGQMELQDELGKGAYGAVKKVLHRPTNVTMAMKEIRLELDKARLDAIIMELDVLNRAVAP
EIVEFYGAFFIESCVYYCMEYMDAGSMDKLEAAGVPEDVLARVAACTVRGLKFLKDELNV
IHRDVKPTNILINTRGDVKLCDFGVSGQLNKSLAKTNIGCQSYMAPERIQGESRGQGDAT
YSVSSDVWSLGLTIVEIGIGRYPYPPEAYENVFSQLTAIIHGDPPELPEDKYSSVAREFV
ARCLDKHPSMRASYTQLLNHPWIVNDAESKVDMPAWVTTALAYRDAQKAPPSQPNGEEGV
PHSV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaatggaactccaggatgaactaggcaaaggcgcatacggcgcagtcaagaag
gtccttcataggccaacgaacgtgacgatggcgatgaaggaaattcgactggagctcgac
aaggcaagattagatgcgatcatcatggagctggatgttctcaatcgcgccgtcgcgcca
gaaatcgtcgagttctacggcgctttcttcatcgaatcttgcgtttactactgcatggag
tatatggacgccggtagcatggacaaactcgaggccgcaggtgtgccggaagacgtgctg
gcacgggtggcggcttgcaccgtgcggggtttgaagttcctgaaggacgagctgaacgtc
atacatcgagacgtaaagccaaccaacatcttgattaacacgcgaggggatgtgaagcta
tgcgattttggagtgtctggtcagttgaataagtccctggcgaagaccaatatcggctgc
caaagctacatggcgcctgagcgcatacagggtgaatcacgaggtcaaggcgatgcgacc
tacagcgtatcttccgacgtgtggtcacttggcctgaccatcgttgagattggcattggt
cgatatccgtaccctcccgaggcctacgagaacgtcttctcgcagttgacagccatcatt
catggcgacccaccagaattaccggaagacaaatactcgtcagtggctcgggaattcgtt
gctcgttgcttagacaagcacccgagcatgcgtgcaagctacacgcagctcttgaaccac
ccatggatcgtcaacgacgccgagagcaaggttgacatgccagcttgggtcaccaccgct
ttggcctaccgcgatgctcagaaggcgccgccttcacaacccaacggcgaggagggcgtg
ccgcactcggtgtaa

DBGET integrated database retrieval system