KEGG   Schizophyllum commune: SCHCODRAFT_57589Help
Entry
SCHCODRAFT_57589  CDS       T01331                                 

Definition
glycoside hydrolase family 15 and carbohydrate-binding module family 20
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
scm  Schizophyllum commune
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCHCODRAFT_57589
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SCHCODRAFT_57589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 576 aa AA seqDB search
MGLASTVSLALLGLCSLARAQTSAADAYVSAESPIAQAGILANIGPSGSKSHGAASGVII
ASPSTSNPDYLYTWTRDAALVSRALVDEFIEGESSLQSVIDSYVSSQQKLQRVDNPSGSY
TSGGLGEPKFNIDLTAFTGAWGRPQRDGPALRAITLITYGNHLLSSGNTSYVTDTIWPVV
KADLDYVVSYWNQTGFDLWEEVSSSSFFTTAEQHTALRLGATFATAVGASASTYLTQADN
VLCFLQSYWNSNGGYATANTGGGRSGIDANTVLTSIHTFDIEAGCDSVTFQPCSDRALSN
LKVYVDSFRGLYSINPTGATDPILTGRYKEDVYYNGNPWYLTTFAVAEQLYDALNTWDKL
GSLDVTSTSLAFFKQFDSSITAGTYASSTSEYATLTSAIRNWADGFLEVLADFTPADGGL
TEQIDKSSGNPTSAADLTWSYASAITAFKARGGAIPASWGAAGLTVPATCSTGGGGGSGG
DTVAVTLNVQATTVYGENIYVTGSVNQLANWSPDNAIALNADNYPTWSVTVNLPANTQIE
YKYIRKNNGQVTWESDPNRSITTSASGSFTQNDTWR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcgcttccactgtctcgctcgccctcctcggcctctgctcgctcgcccgtgct
cagacgagcgcggcggacgcgtatgtttcggcggagtcgcctattgcgcaggcgggcatc
ttggccaacatcggccccagcggctcgaagtctcacggtgctgcctccggtgtcatcatc
gcatccccctcgacgtcgaacccggattacctgtacacctggacgcgcgacgctgctctc
gtttctcgcgctctcgtcgatgagttcatcgagggcgagtcgagcctgcagtcggtcatc
gactcgtatgtcagctcgcagcagaagctgcagcgcgtcgacaacccctctggctcgtac
accagcggcggcctcggcgagcccaagttcaacatcgacctgactgccttcactggcgct
tggggacgccctcagcgcgatggcccggctctgcgtgctatcaccctcatcacctacggg
aatcatctgcttagctccggcaacacctcatacgtcacggacactatctggccagtcgtg
aaggctgacctggactacgtcgtctcgtactggaaccagactggcttcgacctctgggaa
gaggtcagctcctcgtcgttcttcacgactgccgagcagcacaccgccctccgcctcggt
gccaccttcgccaccgccgtcggcgcctccgcgtccacctacttgacgcaggccgacaac
gtgctctgcttcctgcagtcgtactggaacagcaacggcggctatgcgacggccaacacc
ggcggcggccgctctggcatcgacgccaacacggtcctcactagcattcacaccttcgac
atcgaagccggctgcgactcggtcaccttccagccctgctctgaccgcgcgctgtctaat
ctgaaggtttacgtcgactcgttccgcgggctttactccatcaaccccaccggtgccacc
gaccctatcctcaccggccgctacaaggaggacgtgtactacaatggaaatccttggtac
ctcaccaccttcgccgtcgccgagcagctctacgacgcgctcaatacctgggacaagctc
ggctcgctcgacgtcaccagcacctccctcgccttcttcaagcagttcgactcctccatc
accgccggcacctacgcgtcctccacctccgagtatgccaccctcacctctgcgatccgc
aactgggccgacggcttcctcgaggttctcgccgacttcacgcctgcggacggcggcctg
acggagcagatcgacaagtcgagtgggaatcccacttcggcagcggacctcacctggagc
tacgcgtccgccatcaccgcgttcaaggcccgcggcggggcgattccggcaagctggggc
gcggcgggcctcactgtgcccgcgacgtgcagcacgggcgggggcgggggcagcggcggt
gacacggtcgctgtcacgctcaacgtccaggctaccactgtctacggcgagaacatctac
gtgaccggcagcgtcaaccagctcgccaactggtccccggataacgccatcgcgctcaat
gctgacaactacccgacctggagtgtgaccgtcaacctgcccgccaacacccagatcgag
tacaagtacatccgcaagaacaacgggcaggttacgtgggagtccgaccccaacaggagc
atcactacctccgcgtcgggctccttcactcagaatgacacctggcgctaa

DBGET integrated database retrieval system