KEGG   Schizophyllum commune: SCHCODRAFT_58306Help
Entry
SCHCODRAFT_58306  CDS       T01331                                 

Definition
glycoside hydrolase family 15 protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
scm  Schizophyllum commune
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scm00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 470 aa AA seqDB search
MAFTITASLVAIGLAAFAKAQSSTVEAYISSESPIAQAGILAAIGPDGENSGGAAAGVIV
ASPSDSDPDYLYTWTRDAALVSRVLVDQFTQGGDSSLQSVIESYVSAQDTLQHLDNPSGG
YDSGGLGEPKFNIDLTAFTDAWGRPQTDGPALRALTLITYGNSLQSGDNSSYVTDTLWPI
IKADLDYVVQYWNQQTFDLWEEVQSSGSFFTTVVQHAALRQGVSFASAVGDDGPSYSSAA
DSVLCTAQSFWNEDGGYFNANQGGGRSGIDNNAVLASIHTFDVEAGCDSNTFQPCSDRAL
SNLKVYVDSFRGLYSINPTGDTDAILTGRYKEDSYQGGNPWYLNTFAVAEQLYDALTTWD
QVGSIDVTSTSLAFFQQFSDSIAEGSYDSSSDEYSTLTSAIHDWADGFIEIIANYTPSDG
SLAEQIKKDSGEPASALDLTWSYASAVTAFNARDGFVPASWGAANVTASC
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaccatcaccgcttccctcgtcgccatcggcctcgctgccttcgctaaggcg
cagtccagcactgttgaggcgtacatctcttcggagtcgcccatcgcgcaggctggcatt
ttggcggccattggccccgacggcgagaactctggcggtgctgctgctggcgtcattgtc
gcctctccctccgattcggaccccgactacctgtacacctggacgcgcgacgccgcgttg
gtctcgcgggtcctcgttgaccagttcactcagggcggcgactcgagcttgcagagcgtc
atcgagtcgtatgtgtctgctcaggacaccctccagcacctcgacaacccctccggtggc
tacgactctggagggctcggcgagcccaagttcaacattgacctgacggccttcacggac
gcttgggggcgccctcagactgatggtcccgcgctccgcgctcttacgctcatcacgtac
ggtaactctctacagagcggtgacaactcgtcctatgttacggacaccctctggccgatc
atcaaggccgacctggactacgtcgtccagtactggaaccagcagaccttcgatctgtgg
gaggaggtccagtcctcgggctcgttcttcacgaccgtcgtccagcacgccgcgctccgc
cagggcgtcagcttcgcgagcgctgttggggacgatggcccgtcctacagctccgcggcc
gatagcgtcctatgcaccgcgcagtcgttctggaacgaggacggcggctactttaatgcg
aaccagggcggcggccgctccggcatcgataacaacgccgtgctcgcgagcatccacacc
ttcgacgtcgaggcgggctgcgattcgaacaccttccagccgtgctctgaccgcgcgctg
tccaacctgaaggtgtacgtcgactcgtttcgcggtctctacagcatcaacccgaccggc
gacacggacgctatcctcactggccgctacaaggaggactcgtaccagggcggcaacccc
tggtacctcaacaccttcgccgtcgccgagcagctctatgacgcgctcacgacctgggac
caggtcggctcgatcgacgtcacgtccacctcgctcgccttcttccagcagttctccgac
tccatcgccgagggctcgtacgactcgagctcggacgagtacagcacgctcacgtcggcg
atccacgactgggcggacggcttcatcgagatcatcgcgaactacacgccgagcgacggc
tcgctcgcggagcagatcaagaaggacagcggcgagccggcgagcgcgctggacctgact
tggagctatgcgtcggcagtcacggcgttcaacgcgcgcgatgggttcgtgcctgccagc
tggggcgccgccaatgtgactgccagctgttaa

DBGET integrated database retrieval system