KEGG   Schizophyllum commune: SCHCODRAFT_58437Help
Entry
SCHCODRAFT_58437  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
scm  Schizophyllum commune
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCHCODRAFT_58437
   01212 Fatty acid metabolism
    SCHCODRAFT_58437
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCHCODRAFT_58437
   00650 Butanoate metabolism
    SCHCODRAFT_58437
  Lipid metabolism
   00062 Fatty acid elongation
    SCHCODRAFT_58437
   00071 Fatty acid degradation
    SCHCODRAFT_58437
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCHCODRAFT_58437
   00310 Lysine degradation
    SCHCODRAFT_58437
   00380 Tryptophan metabolism
    SCHCODRAFT_58437
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCHCODRAFT_58437
Enzymes [BR:scm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCHCODRAFT_58437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 263 aa AA seqDB search
MSTQYEHILTSRPEPAVELITLNRPKALNALSTPLFLELGKALAAADADEQVGAIVLTGS
EKAFAAGADIKEMKDKTFSDVYKNNYLANWQSALTTIRKPIIAAVSGYALGGGCELALMC
DIILASPTAKFGQPEINLGVIPGGGGSQRLTRAIGKSRAMELVLTGRQINAQEAAQWGLV
SRVVAEGEGEVVKEAVKMANEIAGKGQIAVQAAKEVVNAAYELDLAEGLRFERRTFQGLF
ATNDQKEGMAAFAEKRKPNFTHN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcagtacgagcacatcctcacgtcgcgtcctgagcccgccgttgagctcatc
acgctcaaccggcctaaggcgctgaatgcgctgagcactcctctcttcctggagcttggg
aaggcgcttgctgcagcggatgcagacgagcaggtcggcgcgatcgtgctaacgggctcg
gagaaggccttcgccgctggtgcggacatcaaggagatgaaggacaagaccttctccgac
gtctacaagaacaactacctggcgaactggcagtccgcactcacgacgatccgcaagccc
atcatcgcggccgttagcggctacgccctcggcggcggctgcgagcttgccctcatgtgc
gacatcatcctcgcatccccaaccgccaagttcggccagcccgagatcaacctgggcgtc
atccccggcggaggtggctcccagcgccttacgcgcgccatcggcaagtcgcgcgcaatg
gagctggtgctcaccggccggcaaatcaacgcgcaggaggcggcgcagtgggggctggtc
agccgtgttgttgcagagggcgagggtgaggtagtgaaggaggcggtgaagatggcgaat
gagattgccgggaagggtcagattgcggtgcaggcagcgaaggaggtggttaatgctgcg
tacgagctcgacttggcagagggcttgcggtttgagcgccgaacgttccagggtctgttc
gcgacgaacgaccagaaggagggcatggctgcgttcgcggagaagagaaagcctaacttc
acgcacaactga

DBGET integrated database retrieval system