KEGG   Schizophyllum commune: SCHCODRAFT_58452Help
Entry
SCHCODRAFT_58452  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
scm  Schizophyllum commune
Pathway
scm00062  Fatty acid elongation
scm01100  Metabolic pathways
scm01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    SCHCODRAFT_58452
Enzymes [BR:scm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     SCHCODRAFT_58452
Lipid biosynthesis proteins [BR:scm01004]
 Fatty acid synthase
  Component type
   SCHCODRAFT_58452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest
Motif
Other DBs
NCBI-GeneID: 9591330
NCBI-ProteinID: XP_003029910
JGI: Schco1_58452
UniProt: D8QCX6
Position
Unknown
AA seq 293 aa AA seqDB search
MWTTLTCLLSFTFLSVLASPTQSPRPLVIWHGLGDSHSSPGMVDFQDLIKEVHPGIFIHS
VRIEEALDKDREAGFHGNVNAQLGLVADELSAIPELEDGFDAIGFSQGGQFLRAYVERYN
SPPTYNLITFGSQHLGIADIPECGTYDFLCKSARRIVLGAVYGHWAQENLIQAQYFRDPS
RYAEYLAANHFLADINNEIPGQRNATYKENLQTLENLVLIIFSEDKTVVPKESAWFEKMI
VPMRQQPIYIEDWIGLKELDESGRIIFGVCDGEHMQLGDCWKDYVKKYVGSLV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtggacgacgctgacatgcctgctttcgttcaccttcttgtctgtgttggcgtcgccg
acgcagtctccacgtcctctagtcatatggcacggacttggcgactcacattcgtctcct
gggatggttgatttccaggacctcatcaaggaggtgcatccaggaatcttcatccattct
gtacggatagaggaggcactcgacaaggaccgcgaggccggattccacggcaacgtcaac
gcacagctggggctcgtcgcggacgagttatctgccatcccagagctagaggatggattc
gacgccatcggcttctcgcagggcggacaattcctccgcgcctatgtggaaagatacaac
tcccctcccacgtacaacttgatcacctttggctcccagcatctgggcatagctgacatc
cccgaatgcggcacgtacgactttctctgcaagtcagcgcgtcgcattgtcctcggtgcc
gtctatggccactgggcgcaagagaacctcattcaggcccaatactttcgcgacccctcc
cgctacgcggagtacctggccgcgaaccactttttagctgacatcaacaacgagataccc
ggccagcggaacgcgacatacaaggagaacctgcagacgctggagaatctcgtgctgatt
atcttctcggaggacaagactgttgttcccaaggagagcgcttggttcgagaagatgatc
gttcccatgcgccagcagccaatatatatcgaagactggatcgggttgaaggagcttgat
gagtcggggaggattatcttcggcgtgtgcgatggcgagcatatgcagctgggcgactgt
tggaaggactatgtgaagaagtatgtcgggtcgctcgtgtag

DBGET integrated database retrieval system