KEGG   Schizophyllum commune: SCHCODRAFT_58492Help
Entry
SCHCODRAFT_58492  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 711 aa AA seqDB search
MVVDPPSHKRRSQGLRRVNGASDLQPRLDVPPAGRRMAADGTYLSPLRQLTTNILETYHI
CNPQFRYEAAHNPRRVLTKPSKPSHNDGYDNEDYDYILYVNDWLGNEEGHKYLILDILGQ
GTFGQVVKCQNMKTHEIVAVKVVKNKPAYFNQSMMEVTILDLLNKQCDPNDEHHILRLRD
SFIHRQHLCLVFELLSSNLYELIKQNQFQGLSTQLVKVFMAQLLDALTVLKEAHLIHCDL
KPENILLKSLQSPQIKVIDFGSACHERQTVYTYIQSRFYRSPEVLLGMPYTTAIDMWSLG
CIAVELFLGLPLFPGTSEYNQLTRIIEMLGMPPLSMLNSGKQTHQFFDSVDTYNPATGQP
EKKYTLKSIQQYSREHNTNEQPGKQYFKATNLPDIISGAPMPAAKPNRQNEMEKVELNNR
AAFIDFCKGLLDLNPVTRWTPQQARGHPFITGEKYKGPYVPGGMPQPSPAPPSSSPDPKR
PYGGLVPQPAKGTRAFQDAASYNQHLAQHQAYTAQAQAASANTFRNPYLTPNNTQPSTQP
PAYTQDASYAPSAQPQQQQAQQQHAAAQTQAQAGAQQVQYSANSSAPFNHRVSAHQTSAQ
MIPSNSMPQYSGQPPQLQPNVPPNTYYPNQRSRANTINNQMDNIPPALARLQHMKQDVIA
GGRNALTPVLNRDDAMREWEQRQQQGKASKFQPYPQLEHLQQQAEMAAASG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttgatcctccatcacataagcgacgctcgcagggtcttcgtcgggtaaatggt
gcgagcgatctgcagccgcgactggacgtcccgcctgcaggaagaagaatggcggctgat
gggacatatctctcgccccttcgtcagctcactaccaacatcttggagacgtaccatatc
tgcaacccccagttccgatacgaggcggcccataacccgcgacgtgtcctcaccaagccc
agcaagccctcacacaatgacggctacgacaacgaagactacgactatattctgtacgtg
aacgactggctggggaacgaggagggccacaaatacttgatcttggatatactggggcaa
ggcacgttcggccaagttgtcaagtgtcaaaacatgaagacgcacgagatcgtggccgtc
aaggtcgtcaagaacaagcctgcatacttcaatcagagtatgatggaggtgactatcctc
gacctgttgaacaagcagtgcgaccctaatgacgagcaccacatcttgcgattgcgtgac
tccttcatccaccggcagcatctatgcttggtgttcgaattgctgtcatccaacctctac
gagttgatcaagcagaaccagttccagggtctcagcactcagctcgtcaaggtctttatg
gcgcaacttcttgatgccttgaccgttttgaaggaggcgcacctcatccactgcgatttg
aaaccggagaacatcctcttgaagtcactgcagtcgccacagatcaaggtcatcgacttt
gggtcggcctgtcatgagcgacagacagtgtacacttacattcagtcgcggttctatcga
tcgccggaagttctcctgggaatgccttacacgaccgccatcgacatgtggtccctgggc
tgtatcgcagtggagctgttccttggtttaccgctcttcccgggtacgagcgagtacaac
caactgactcgcatcattgagatgctcgggatgccgcctctcagcatgctgaactcgggg
aagcagacgcaccaattctttgactctgtcgatacctataaccctgcgaccggacagcca
gagaagaaatataccctcaagagcatccagcagtactcgcgggagcacaacacgaatgag
cagcctgggaagcaatacttcaaggcgacgaacctcccggacatcatctcaggtgccccg
atgcctgcggcgaagccgaaccgtcagaacgagatggagaaggtagagctcaacaaccga
gccgcattcatcgacttctgcaagggcttgctggacttgaaccctgtcacgcgttggacg
ccgcagcaggccagagggcaccctttcatcaccggcgagaagtacaaggggccgtatgtg
cccggcggaatgcctcagccgtcgccagctccgccttcaagctcgcctgatccaaagcgg
ccgtatggcggtcttgtgccccaaccggccaagggtacgcgtgcgttccaggacgcggcg
tcgtataaccagcacctggctcaacatcaggcctacacggcgcaagcgcaggcggcgtcc
gcgaacaccttccgcaacccgtacttgacgccgaacaacactcaaccatcgacgcagccg
ccagcgtatactcaagacgcgtcctacgcgccctcggcgcagcctcaacagcagcaggcg
cagcaacagcacgcggcggcgcagacacaagcgcaggcaggcgctcaacaggtgcagtac
agcgctaattcctctgcaccctttaatcatcgcgtttctgctcatcagacgtccgcccaa
atgattccgagcaattcgatgccgcaatactctggccagccacctcagctgcagccgaac
gtgcctcccaacacgtactacccgaaccagcggagccgggccaacaccatcaacaaccag
atggacaacatcccgccggcgctggcaaggctgcagcacatgaagcaggacgtcattgct
ggtgggcgcaatgccttgacgccggtgctcaaccgcgacgatgcgatgcgcgagtgggag
cagcggcaacagcagggcaaggccagcaagttccagccgtacccgcagttggagcacctg
cagcagcaggccgaaatggcggcggcgtcgggc

DBGET integrated database retrieval system