KEGG   Schizophyllum commune: SCHCODRAFT_58492Help
Entry
SCHCODRAFT_58492  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K18670  dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SCHCODRAFT_58492
Protein kinases [BR:scm01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   SCHCODRAFT_58492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Choline_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 9594185
NCBI-ProteinID: XP_003029435
JGI: Schco1_58492
UniProt: D8QCI1
Position
Unknown
AA seq 711 aa AA seqDB search
MVVDPPSHKRRSQGLRRVNGASDLQPRLDVPPAGRRMAADGTYLSPLRQLTTNILETYHI
CNPQFRYEAAHNPRRVLTKPSKPSHNDGYDNEDYDYILYVNDWLGNEEGHKYLILDILGQ
GTFGQVVKCQNMKTHEIVAVKVVKNKPAYFNQSMMEVTILDLLNKQCDPNDEHHILRLRD
SFIHRQHLCLVFELLSSNLYELIKQNQFQGLSTQLVKVFMAQLLDALTVLKEAHLIHCDL
KPENILLKSLQSPQIKVIDFGSACHERQTVYTYIQSRFYRSPEVLLGMPYTTAIDMWSLG
CIAVELFLGLPLFPGTSEYNQLTRIIEMLGMPPLSMLNSGKQTHQFFDSVDTYNPATGQP
EKKYTLKSIQQYSREHNTNEQPGKQYFKATNLPDIISGAPMPAAKPNRQNEMEKVELNNR
AAFIDFCKGLLDLNPVTRWTPQQARGHPFITGEKYKGPYVPGGMPQPSPAPPSSSPDPKR
PYGGLVPQPAKGTRAFQDAASYNQHLAQHQAYTAQAQAASANTFRNPYLTPNNTQPSTQP
PAYTQDASYAPSAQPQQQQAQQQHAAAQTQAQAGAQQVQYSANSSAPFNHRVSAHQTSAQ
MIPSNSMPQYSGQPPQLQPNVPPNTYYPNQRSRANTINNQMDNIPPALARLQHMKQDVIA
GGRNALTPVLNRDDAMREWEQRQQQGKASKFQPYPQLEHLQQQAEMAAASG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttgatcctccatcacataagcgacgctcgcagggtcttcgtcgggtaaatggt
gcgagcgatctgcagccgcgactggacgtcccgcctgcaggaagaagaatggcggctgat
gggacatatctctcgccccttcgtcagctcactaccaacatcttggagacgtaccatatc
tgcaacccccagttccgatacgaggcggcccataacccgcgacgtgtcctcaccaagccc
agcaagccctcacacaatgacggctacgacaacgaagactacgactatattctgtacgtg
aacgactggctggggaacgaggagggccacaaatacttgatcttggatatactggggcaa
ggcacgttcggccaagttgtcaagtgtcaaaacatgaagacgcacgagatcgtggccgtc
aaggtcgtcaagaacaagcctgcatacttcaatcagagtatgatggaggtgactatcctc
gacctgttgaacaagcagtgcgaccctaatgacgagcaccacatcttgcgattgcgtgac
tccttcatccaccggcagcatctatgcttggtgttcgaattgctgtcatccaacctctac
gagttgatcaagcagaaccagttccagggtctcagcactcagctcgtcaaggtctttatg
gcgcaacttcttgatgccttgaccgttttgaaggaggcgcacctcatccactgcgatttg
aaaccggagaacatcctcttgaagtcactgcagtcgccacagatcaaggtcatcgacttt
gggtcggcctgtcatgagcgacagacagtgtacacttacattcagtcgcggttctatcga
tcgccggaagttctcctgggaatgccttacacgaccgccatcgacatgtggtccctgggc
tgtatcgcagtggagctgttccttggtttaccgctcttcccgggtacgagcgagtacaac
caactgactcgcatcattgagatgctcgggatgccgcctctcagcatgctgaactcgggg
aagcagacgcaccaattctttgactctgtcgatacctataaccctgcgaccggacagcca
gagaagaaatataccctcaagagcatccagcagtactcgcgggagcacaacacgaatgag
cagcctgggaagcaatacttcaaggcgacgaacctcccggacatcatctcaggtgccccg
atgcctgcggcgaagccgaaccgtcagaacgagatggagaaggtagagctcaacaaccga
gccgcattcatcgacttctgcaagggcttgctggacttgaaccctgtcacgcgttggacg
ccgcagcaggccagagggcaccctttcatcaccggcgagaagtacaaggggccgtatgtg
cccggcggaatgcctcagccgtcgccagctccgccttcaagctcgcctgatccaaagcgg
ccgtatggcggtcttgtgccccaaccggccaagggtacgcgtgcgttccaggacgcggcg
tcgtataaccagcacctggctcaacatcaggcctacacggcgcaagcgcaggcggcgtcc
gcgaacaccttccgcaacccgtacttgacgccgaacaacactcaaccatcgacgcagccg
ccagcgtatactcaagacgcgtcctacgcgccctcggcgcagcctcaacagcagcaggcg
cagcaacagcacgcggcggcgcagacacaagcgcaggcaggcgctcaacaggtgcagtac
agcgctaattcctctgcaccctttaatcatcgcgtttctgctcatcagacgtccgcccaa
atgattccgagcaattcgatgccgcaatactctggccagccacctcagctgcagccgaac
gtgcctcccaacacgtactacccgaaccagcggagccgggccaacaccatcaacaaccag
atggacaacatcccgccggcgctggcaaggctgcagcacatgaagcaggacgtcattgct
ggtgggcgcaatgccttgacgccggtgctcaaccgcgacgatgcgatgcgcgagtgggag
cagcggcaacagcagggcaaggccagcaagttccagccgtacccgcagttggagcacctg
cagcagcaggccgaaatggcggcggcgtcgggc

DBGET integrated database retrieval system