KEGG   Schizophyllum commune: SCHCODRAFT_58502Help
Entry
SCHCODRAFT_58502  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
scm  Schizophyllum commune
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCHCODRAFT_58502
Enzymes [BR:scm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SCHCODRAFT_58502
Exosome [BR:scm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCHCODRAFT_58502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 324 aa AA seqDB search
SILQGGYQHPVSRAWQSPRQLTKSMLMYPIFITDDPDAAEEMTTLPGQRRWGVNKLEGFI
GPLVQKGLKSVILFGVPMKAQKDEKGTLADDPDGPVILAVKKLRSLFPDLYIACDVCLCE
YTSHGHCGILHEDGTINTPPSVVRIAQVAVSYARAGAHCVAPSDMMDGRIKSIKQGLMDA
GLANKCTLMSYSAKFASALYGPFRDAVLSAPSFGDRKCYQLPPAAKGLARRAILRDVNEG
ADIIMVKPSLPYLDIIADAAQLAPDHPTACYQVSGEFAMVHAGARAGVYDLKTMAFETVN
SMIRAGAGIILTYFTPEFLDWLDE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
tcgatcttgcagggcggctaccagcacccagtctcgcgcgcatggcagagcccgcgccag
ctcacgaaatccatgctcatgtaccccatcttcatcaccgacgaccctgatgccgctgag
gagatgacgacgctgccaggtcagcgtcgctggggtgtcaataagctcgagggcttcatc
gggcccctcgtccagaagggattgaagagcgtgatcctgttcggtgtgcccatgaaggcg
cagaaggacgagaagggaacgctagcggacgaccctgatggcccggttatcctcgctgtc
aagaagctgcgctccctcttccccgacctctacattgcgtgcgacgtgtgtctctgcgag
tacaccagccatggacactgcggcatcctgcacgaggacgggacgatcaacaccccgccc
tcagtcgtgcgcattgcgcaagtcgcggtcagctacgcgcgcgcaggtgcacactgcgtt
gcgccgagcgacatgatggacggtcgtataaaatcaataaagcagggtctcatggacgca
gggcttgcgaacaaatgtacactgatgtcgtactcggccaaattcgcgagtgcgctctac
ggtcccttcagagacgctgtgctgagtgcaccttccttcggtgaccgcaaatgctaccag
ctgcctccagctgcgaagggactggcgcgtcgcgctatcttgcgcgatgtgaacgagggc
gccgacatcatcatggtcaagccttccctgccatatctggacatcatcgcggacgctgcg
cagcttgcgccggaccaccctactgcctgctaccaggtcagcggcgagttcgctatggtg
cacgccggcgcgcgcgcgggtgtctacgacctgaagacgatggcgttcgagacggtgaac
tcgatgattcgtgcaggcgctggaatcatcctgacctacttcacgcccgagttccttgac
tggctggatgagtaa

DBGET integrated database retrieval system