KEGG   Schizophyllum commune: SCHCODRAFT_58649Help
Entry
SCHCODRAFT_58649  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SCHCODRAFT_58649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 546 aa AA seqDB search
MTAHSASAASAGPCQVSPGGTYTINQIVAGCKIFIRRPGPDGKSEEERLAEILSIRDKPE
NAYARQNNQAPTKPEDKLEFFVHWDTFNKRLDDWVPGSRLVLTRELTWPPPQKVDPKAKK
APMTPKAPPGKAPPRGHQQDLLKRATSNAALAASPPPATPQFVGRFSPAPSPSPSVVPSK
RKAPSERAEEEEDEDEDDDADADGDADMDVDAEGEEGEGETFELNMDDATHGQPDPAQGL
SKEEEIQTLRYRGSMTQSVSEVARMKNLNRLQIGKHEVDAWYFSPYPKEYAHLPVLYICE
FCLSFFPSQMMLGRHRKRCTLMHPPGNEIYRHEDISFYEIDGKRQLTWCRNLSLLSKCFL
DHKTLYYDVTPFLYYVMAQRDSTGCHMVGYFSKEKECAEGYNVACILTLPQHQRHGFGKL
LIEFSYALSRKEKKAGSPEKPLSDLGLLGYRSYWAEVIVGYLMQCGDDVSIEEISNATFI
TQADVMNTCVTLGLFRHYKGQHRICLTPSIVEKYEKKLKKPRRRIHPECLQWTPPVFTRE
QLRFGW
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccattccgcctctgctgcttcggcagggccatgccaggtcagccccggaggg
acttacacgataaatcaaattgtggccggctgcaagatcttcattcgccgccctggtccc
gatggcaagtcagaggaggaacgccttgcagagatcctttccattcgcgacaagcccgag
aacgcatatgcgcgacagaacaatcaggcgcccacaaagccggaggacaagctcgagttc
tttgtgcattgggacacctttaacaagcgcttggacgactgggtccctgggtcgcggctg
gtcttgacgcgcgagttaacatggccaccaccgcagaaggtcgacccgaaggcgaagaaa
gctcccatgacgccgaaggcaccgcccgggaaggcgccaccgcgcggacaccagcaggac
ttgctcaagcgcgcgacgtccaatgcggcgctcgctgcatctcctccgcctgctacgcct
caattcgtgggtcgcttctcacccgcaccctcaccttcgccctctgtcgtgccgtcgaag
cgcaaggcaccctccgaacgcgcagaggaggaggaagatgaggatgaggacgacgacgcc
gatgctgacggtgacgccgacatggatgtcgacgctgaaggcgaggagggcgagggcgag
acgttcgagctgaacatggacgacgccacccatggacagccggaccccgcacaggggctg
agcaaggaggaggagatccagacgcttcgctatcgcggaagcatgacgcagagcgtgtct
gaggtcgcgcgcatgaagaacctgaaccgactccagattgggaagcacgaggtggacgcg
tggtacttcagtccgtacccgaaggagtacgcgcatctgcccgtgctgtacatctgcgag
ttctgcctctcattcttcccgtcgcaaatgatgcttggccggcaccgaaagcgctgcacc
ctcatgcacccgccggggaacgagatctatcgacatgaggacatctcgttctatgagatc
gacggcaagcggcagcttacctggtgcaggaacctgagcttgctgtcgaagtgcttcctc
gaccacaaaacgctttactacgacgtaacgccgttcttgtattatgttatggcccagcgt
gattcgaccggctgccacatggttggctacttctcgaaagagaaggagtgtgccgaagga
tacaacgtcgcctgtattcttacgctgccgcagcatcagcgccatgggttcgggaagctg
ctcatcgagttttcgtacgctctgagcaggaaggagaagaaggcgggcagcccggagaag
ccgctcagcgatctgggtctgctcggctaccggtcgtactgggcggaggtcatcgtcggc
tatctcatgcaatgcggcgacgacgtgagcatcgaggagatctcgaacgcgacgttcatc
acccaggcagatgtcatgaatacctgcgtgacgcttggtctcttccgccactacaagggt
cagcaccgcatatgcttgacgcctagcatcgtggagaagtacgagaagaagttgaagaag
ccgcggcggaggatacatcccgagtgcctccagtggacgccgcctgtattcacgcgcgag
cagctccgtttcggctggtag

DBGET integrated database retrieval system