KEGG   Schizophyllum commune: SCHCODRAFT_60529Help
Entry
SCHCODRAFT_60529  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
scm  Schizophyllum commune
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SCHCODRAFT_60529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2061 aa AA seqDB search
MEQIPRLKSLLLSIANGATAPNLEQDVFNALNASKDQLIRIFDVGARNTAEKKELEAGRM
HIKDSQRALNREFVQQALFLAQELDCSEAYVTEILWEVQNEYHNDDPLRWIELSVAVFHR
RRRDLAHCLELLFDLVKLSGDDRSSLRVWARNELIGSPSTVSFPARLMKELENLTNLIAR
TEVARRNARSNTMATGPGLPTGTFALGADVLTARIESLRSERRTIALVLCAVLANDFFGP
SDIKTIVDWLAERPNDPLTYYMLTALFTVIEPSEEPFRQALPRDASLVSHMSQKLAPTTR
WKDTGLKGAILLKWTLFLTDARHLDEKLEARPGLTADELESQTYNAIYAGAFQFLTCVML
HLERQRTPSTRDFDLSQAQLDQREPPPDAFRPLMYATFQSLVRSTISYASPVIRKIKQKQ
EDRGLARGDRQKAPEEQRNDIPTLFAFIGQLYSALPPDSALPFWGSEPLAGVKSLHEQME
VETGKLPNFLQFAVWQTPVPPVGQPHADASMAIALYDMLSGLAHGPQCSELAYNFMARAT
GDVVAGGMLATGSSGGQGVSWAAIFNTLEYWVNLGPPRTAQAQSLIPGASFLGQASAYQP
QPVQQPPKPISISLGEVLLAQAFLRFTATVVRDSLNVRDMMARHVQFHGRHAIQDMAVLI
TLAVPLELKASLFETLAAFAEPGGGSEGTEICMGIWTAMEKEQVIDVRGPTGPSALAVPP
TKGVEVELEEIEVPNKVFPETMGFLRLLTTLAHTPKRISARDRALDAEKLNTVPPTLGQP
YRHPGIGPYVRFVVDTVFANVHSREYKNPSDRWEINDLCLCFIERQLASFAPERLTEVGE
DAAALRAIVENLVVHPGYELAVRLLSDTPLRTTILRYTVDGIDGLASELGQEPFFCSSLI
RVVRIIQRVLEIQDVFLDVLVPLLADAGDVSKVSAHVHPRSYYTRFDQALSFNVAYVPSL
ARCMAAPQYGELVLLAMKIISSLASSHYLPNLATLIERSSESEEILAGLVQILRSDSMQD
VQEAEDYASQVTGAGALDPLTDSASLEQAIRLAALDLFVENTKTERKFPNVAHLFLFSQL
LPTRKGIEDAHALGAKTTCFHAILELVNHAMPKVGDKGKAPAIEGATAPGTPLFLALPGL
AEKCYQVILNLCQHPRTSEVTMRYLRSHDHFFARQLAAMRNYVPETVLEPSVGIQYPDGT
QIQTTVHELSAFLRLRAIVFDLAALDVHEVVSKGRVSAATTTLEVLFGNDTEVAQDIWGL
HPFHDIGQTNIRVVEFVQSLAFEVFDHLQVDPLKLTFLAELDLASCFRKDAHGCDIVDRA
ALISLLTRAKAILWAKGAIADNQDSVKLGQEVFYILESCAVENHRREIGYAMANAYAAWA
RLLNIVLHRCFSRLSPDRRESALFELVHVLPPIAASAQVQAETAVVLAETILTCVVKLRE
NRHNQAMFDMDALPPERLLAICRSILGCIVNSGHNELVRGNLYAALINYLQLAQPQRGAP
TPSEPPLALSLLSSVATREVANGSVVNGRSTSQVELGTVALVKTIVDRLTAIVSRDAISG
TEVWKTVAFILLDALQGLSKADKQQAILSALSRHGILANFVQGLKEADAFLQGVLKPEPD
DLNPLYVYEAKMSLFTQMALTRQGAERLLESRLIAILTECDYLDARPEADQAFMDQDSFL
PSAIHRYHQLFMPALQVLNAMIVTLGDKHATAANAILEFITTHHATIAILIKTDVESLSL
STVEELHLIVSLCTRVLPYVEKEQLASPTTAFGSLHAAVLNLASRCICNSRWIKFVTPQT
ETEGVWAGVHGEGLAPRSKFDDAVQRKSRLLRHALISYLGVASGFTEEDLTLVLSPLTAL
PRSEEQRGQFSAAVPTLGDALQALNELCTEVQEAFTQLRYVAAELATRDTVRVDNVEEIV
RDIDPKVLRGLEIGRKRALICREYERIQDSLRDDAKLVLTTTEMLLLLLWRHASHYVEHP
AASQSQLRSSLAQSIRFLSIPPADEMRMDVYAKLAPALQRLEGLDTVRFLFRSEWQSNQM
YIGIMLARLRGLTEVGVLTEA
NT seq 6186 nt NT seq  +upstreamnt  +downstreamnt
atggagcagattccacgactcaaatccctgctcttgtccatcgcaaacggcgccaccgcg
ccgaaccttgaacaagatgtcttcaacgctctgaacgcgtcgaaagaccagttgatacgt
atattcgatgtgggggcacggaatacggcagagaagaaggagctagaggctggtcgcatg
cacatcaaggacagccagcgtgcgctgaaccgcgaatttgtacaacaggcgctcttcctg
gcgcaagagctcgactgctcagaagcttacgtcaccgagattctgtgggaggtgcagaac
gagtaccacaacgacgaccccttgcgctggatcgagctctcagtggcggtcttccatcga
cgacggcgagacctggcacattgcctcgaactactatttgacctggtcaagctttcaggc
gatgatcggtcgtccctcagagtgtgggcacgtaatgaactcatcggcagcccatctacc
gtgtcattccccgcgcgcctcatgaaggagctggagaacctgacgaacttgatcgcgcga
acagaggtggcgagaagaaacgcgcgcagcaacacaatggccacagggccaggtctaccc
acaggaacgttcgcgctcggtgctgatgtcctcactgctcgcatcgagtccctcaggagc
gagaggcgaacaatagccctcgtgctctgcgccgtcctcgcaaatgacttcttcggcccg
tccgacatcaagacgattgtcgactggctagctgaacggccaaacgacccactgacgtac
tacatgctcaccgccctcttcaccgtgatcgagccgtcagaggagcccttccgccaagct
ctaccccgcgacgcgtcgctcgtgtcacacatgtctcaaaagcttgccccgaccactcgc
tggaaggacaccggcctgaagggcgcgatcttgctgaagtggactctcttcctgacagac
gcgcgacatctggatgagaagctcgaagcgcgccccggtctcacggccgacgagcttgag
tcccagacgtacaatgctatctacgccggcgccttccaattcctcacttgcgtcatgctg
cacctggaacggcaacgaactccttcgacgcgcgactttgacctttctcaagcgcagctc
gaccagcgggaaccacctccagatgctttcaggcctttgatgtatgctaccttccagagc
ctggttcgcagcaccatctcgtatgcgtcccctgtcatccgcaagatcaagcagaaacaa
gaggatcgcgggctcgcgcgcggcgaccgacaaaaggcgccagaggagcaacgcaacgac
atcccgaccctcttcgcctttatcggccagctatactccgccctgccacccgacagtgcc
ctgcccttctggggctccgagccgctcgcgggcgtgaagagcctgcacgagcagatggag
gtcgagactggcaagctccccaacttcctccaattcgccgtctggcagacgcccgtcccg
cccgtcgggcagccgcacgcggacgcgtcgatggcgatcgcgctgtacgacatgctcagc
gggctcgcgcacggtccgcagtgcagcgagctcgcgtacaacttcatggcgcgcgcgacg
ggcgacgtcgtcgcgggcggcatgctcgccacgggatcgtctggcgggcagggcgtgtcg
tgggcggcgatcttcaacacgctggagtactgggtcaatttggggccgccgcggacggcg
caggcgcagtcgctcattccgggtgcgtcgttcttgggacaggcgtcggcgtaccagccg
cagccggtgcaacagccgccaaagcctatatcaatctcgctgggtgaggtcttgctggcg
caggcgttcctcaggttcactgcgacggtggtgcgggactcgctgaacgtgcgcgatatg
atggcgcgacatgtccagttccatgggcggcatgcgatccaggacatggccgtactgatc
acgctggcggttccgctcgagctgaaggcgtcgcttttcgagaccctcgccgcgttcgcg
gagcccggtggcggcagcgagggcacggagatatgcatggggatctggacggcgatggag
aaggagcaggtcatcgacgtccgcgggcccaccggtccctccgccctcgccgtacccccg
acaaagggcgtcgaagtcgagctcgaagaaatcgaggtcccgaacaaggtctttcccgaa
acaatgggcttcctgcgcctgctcacaaccctcgcacacaccccaaagcgaatctccgcc
cgcgatcgcgcgctcgacgccgagaagctcaacactgtgccgcccacgctcggccagccg
taccggcacccgggtatcgggccctacgtgcgcttcgtcgtcgacaccgtgttcgccaac
gtgcattcaagggagtacaagaacccatcggaccggtgggagatcaacgatctatgtttg
tgcttcatcgagcgccagctcgcgagcttcgcgccggagcggctgacggaggtgggcgag
gacgcggcagcgctgcgcgcgatcgtcgaaaacctcgtcgtgcacccggggtacgagctc
gcggtgcgcttgctgtcggacacgccgctaaggacgacgattcttcggtatacggtggac
gggatcgacgggctagcctcggagctggggcaagagccgttcttctgctcgtcgctcatc
cgggtggtgcgcatcatccagcgggtgttggagatccaggacgtgtttctcgacgtgctt
gttcccctgctcgcggacgcgggcgacgtgtcgaaggtctccgcgcatgtgcacccgcgc
tcgtactacacacgcttcgaccaggccctctcgttcaacgtcgcgtacgttccgtcgctc
gcacggtgcatggccgccccgcagtatggcgagctggtgctgctggcgatgaagatcatc
agctcgctggcgtcgtcgcactacctgccgaacctcgccaccctgatcgagcgctcctcg
gagtcggaggagatcctcgcgggcctggtgcagatcctgcgtagcgactcgatgcaagac
gtgcaggaggcagaggactacgcgtctcaggtgacgggtgccggtgcccttgaccccttg
acggactctgcgtcgctagagcaagctatccgcctcgccgcgctggacctctttgtcgag
aacacgaagacggagcggaagttcccgaacgtggcgcatctattcctcttcagtcagttg
ttgccgacgcgcaaggggatcgaggacgcacatgcgcttggtgcgaagacgacctgcttc
cacgccatcctcgagctcgtcaaccacgctatgcccaaggtcggtgacaagggcaaggcg
cctgctatcgagggcgcgacggcccctgggacgccgctcttcctcgcactgcccggcttg
gcggagaagtgctatcaagtgatcctcaacctctgccaacacccacggacgtcggaggtg
acgatgcgctacctccgctcgcacgaccatttcttcgcccggcagctcgccgcgatgcgc
aactacgtgcccgagaccgttttggagccgtcggtcgggatacaatacccagacgggaca
cagatccagacgacagtgcacgagctgagcgcgttcttgcgcctgcgggcgatagtgttc
gacctcgccgcacttgacgtacacgaagttgtgtctaagggacgcgtctcggcagccacg
accacgctcgaggtcctcttcggcaacgacaccgaggtcgcgcaggatatctggggcctc
catcccttccacgacatcgggcagacgaacatccgcgtggttgagtttgtgcagtcgctc
gcgttcgaggtgttcgaccacctgcaggtcgacccgcttaagctgactttcctcgccgag
ctcgatctcgcttcgtgcttccgcaaggacgcgcatgggtgtgatattgtcgaccgggct
gcactgatctctctcctcacgcgcgccaaggcgattttgtgggccaagggcgccatcgcg
gacaaccaggactcggtcaagcttgggcaggaggtgttctacatcttggagagctgcgca
gtcgaaaaccacagacgcgagattgggtatgcgatggcgaacgcgtatgcggcgtgggcg
cggcttttgaacattgtgctgcaccgctgcttctcaagactatcaccagatcgtcgggag
agcgccctgtttgagctcgtccacgtcctcccaccaatcgcagcctcggcgcaggtgcag
gccgagacggcagtcgtattggctgagacgatcctgacctgcgtcgtcaagcttcgtgag
aaccggcataaccaagcgatgttcgacatggacgcgctacctccagagcgattgctcgcc
atctgccgaagcatcctcgggtgcatcgtcaacagcgggcacaacgagcttgtgcgcgga
aacctttacgccgccctcatcaattacctgcagctcgcgcaaccacagcgcggcgcaccc
acaccctccgaacctcctctagccctttccctcctatcatccgtcgcaacacgggaagtc
gccaacggcagcgtcgtgaacgggcggagcacctcccaggtcgagctgggcacggtggcg
ctggtgaagaccatcgtggaccggctgacggcgattgtgtcgcgcgacgcgatcagcggg
acggaggtgtggaagacggtcgcgttcatcttgctcgacgcgctgcaggggctgtcgaag
gcggacaagcagcaggcgatactgagcgcgctgtcgcggcatggcatcctggcgaacttt
gtgcagggcttgaaggaggcggatgcgttcttgcaaggggtgttgaagccggagccggac
gacttgaacccgttatatgtgtacgaggcgaagatgtcgctgttcacgcagatggcgttg
acaagacaaggagcggagcggctgctggagtcaaggttgattgccatcttgacggagtgt
gactacttggacgctcgtccagaggcggatcaggcgttcatggaccaagactccttctta
ccatccgctatccaccgatatcaccagctcttcatgccagcgctgcaagtcctgaacgcg
atgatcgtaacgcttggcgacaagcatgcgacggcggcgaacgcgatactcgaattcatc
accacccaccacgctacgatcgccatcctcattaagacggacgtagagtccttgtcgcta
tccacggtcgaggagctgcaccttatcgtctcgctgtgcacgagggtcttgccgtatgtg
gagaaggagcagctagcctcgccgaccaccgccttcggctccctccacgccgccgttctc
aaccttgcctcgagatgcatctgcaacagccgctggatcaagttcgtcacgccgcagaca
gagacggagggtgtttgggcaggtgtgcatggcgagggcctcgccccacgatcaaaattc
gacgacgccgtgcagaggaagtcaagactactccgacacgcgctgatttcctatcttggc
gtcgcgagcgggttcacggaagaggacctgacgctagtgctctcgccgctgactgcgctg
ccgaggagtgaggagcagagggggcagtttagtgctgccgtgcccacactcggcgatgca
ctacaagccctgaacgagctgtgtaccgaggtacaggaggcgttcacgcagttgcgttac
gtggcggcggagctggcgacgagggacacggtgcgggtggataatgtcgaggagatcgtc
cgcgacattgatccgaaggtccttcgggggcttgagatcggcaggaagcgcgccttgatc
tgccgagaatatgagaggatacaggactcgctacgggatgatgcgaagctggtgttgaca
acgacggagatgctcctcctcctgttgtggcgacacgcaagccactacgtcgagcatccg
gcagcgagccagagccagcttcggtcatcactagcacagtcaatacgcttcctgtcgata
ccgcctgcggacgagatgcggatggatgtgtatgcaaaactggcgccggcgttgcagaga
ctggaggggttggatacggtacgtttcctcttcagatctgaatggcagtccaaccaaatg
tatatcggaatcatgcttgcgaggctgcgcggtctgacggaagttggtgtgctcacggag
gcgtag

DBGET integrated database retrieval system