KEGG   Schizophyllum commune: SCHCODRAFT_63517Help
Entry
SCHCODRAFT_63517  CDS       T01331                                 

Definition
glycoside hydrolase family 13 protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scm  Schizophyllum commune
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCHCODRAFT_63517
Enzymes [BR:scm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SCHCODRAFT_63517
Exosome [BR:scm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCHCODRAFT_63517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 681 aa AA seqDB search
MPTAPLDPKAVLEVDGYLEPNVPAIVHRHDLYRQWKDRIDEHEGGYEGFSKGFNKFGLNV
RENGDVVYREWAPNATEAYLIGEFNDWNRISHPMKKDNYGVWEVTVPAKDGVCAIPHDSK
LKISLILPHGERIERIPAWIKRVTQDLNVSPVYEARFWNPPESQKYKFKNSRPPKADNVR
VYEAHVGISTPDGRVGTYKEFTQNILPRIADLGYNVIQLMAVMEHAYYASFGYQVTNFFA
ASSRYGTPEELKELVDTAHGMGLTVLLDVVHSHACKNVLDGLNELDGTDHLYFHGGPKGK
HELWDSRLFNYGSYEVLRFLLSNLRFWLEEYQFDGFRFDGVTSMMYKHHGIGTGFSGGYH
EYFGDSQDVEAVVYLMLANDAVHSMFPTALTIAEDVSGMPLLCIPVDKGGVGFDYRLSMA
VPDMWIKLLKHKADDEWDIGNIVHTLTNRRHGEKSIAYAESHDQALVGDKTLAFWLMDKE
MYTHMSDLTPMTPVIARGLALHKMIRLITHSLGGEGYLNFEGNEFGHPEWLDFPREGNGN
SFHYARRQWNVVDDPLLRYRYLNNFDRAMNRAAGKYRWLEAPQAYVSLKHEGDKVIVYER
AGLVFIFNFHPTQSFSDYRIGVEDAGEYHAVLSSDEKDFGGFENISMGTTYHTTPIEWNG
RKNWMHLQVYIPSRTCLVLAK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgcgcccctcgaccccaaggctgttctcgaggtcgacggctacctcgagccc
aacgtacccgcgatcgtgcacaggcacgacctgtaccggcagtggaaggacaggatcgac
gagcacgaaggcggctacgagggcttctcgaagggcttcaacaagttcgggctcaatgtg
agggagaatggggacgtggtgtaccgcgagtgggcgcccaacgcgacggaggcgtacctc
atcggggagttcaacgactggaaccgcatcagtcaccccatgaagaaggacaactatggc
gtctgggaggttacggtccccgcgaaggacggtgtctgcgctatcccgcacgactcaaag
ctcaagatctcgctgattctgccccatggggagcgcattgagcgtatcccagcctggatc
aagcgcgtcacgcaggacctcaatgtctcccccgtctacgaggcgcgcttctggaacccg
cccgagtcgcagaagtacaagttcaagaactcgcgacctcccaaggcagacaatgtgcgc
gtatacgaggcgcatgttggcatctccactcccgatggacgagtggggacgtacaaggag
ttcacacagaacatccttccccgcatcgccgatctgggctataatgtcatccagctgatg
gccgtcatggagcacgcgtactatgcctcgttcggataccaggtcaccaacttctttgct
gctagttcccggtatggcacgcccgaggagctcaaggaactcgtcgataccgctcatggc
atgggcctgaccgtcctccttgacgtggtccactcccacgcatgcaagaacgtcctggac
ggtctcaacgagctcgacggcaccgatcacctctatttccacggtggtccgaagggcaag
cacgagctttgggacagccgtctgttcaactatggctcttacgaagtcctgcgcttcctt
ctcagcaacctgcggttctggctggaggaataccagttcgacggcttccgctttgatggt
gtgacgagcatgatgtacaagcatcatggtattggcactggtttctctggcgggtaccac
gagtactttggtgattctcaggacgtcgaggccgttgtttacctcatgctggctaacgac
gcagtccactccatgttcccgactgcactcaccatcgccgaggatgtctctggcatgccc
ttgctctgcatccccgtcgacaagggcggcgtcggcttcgactaccgtctctccatggcc
gtcccggacatgtggatcaagctgctcaagcacaaggcggacgacgaatgggacattggc
aacatcgtgcacaccttgacgaaccgccgccatggggagaagagcatcgcatatgcggag
agccacgaccaggcgctggtcggcgataagacgttggcgttttggttgatggacaaagag
atgtacacgcatatgtcggacttgacgcctatgacgccggtcattgctcgtgggcttgcg
ttgcacaagatgatcaggctcatcacccactcactgggtggagaaggctacctgaacttc
gaggggaacgagttcggacatcccgagtggctcgacttccctcgcgaaggcaatggcaac
tccttccactatgctcgccggcagtggaacgttgttgacgacccgctcttgcgctaccgg
tacctcaacaacttcgaccgtgccatgaaccgcgccgccggaaagtaccgctggctcgag
gcgccacaggcctacgtttccctcaagcacgagggcgacaaggtcatcgtttatgagcgc
gccggccttgtcttcatcttcaacttccaccccacccagagcttctctgactaccgcatc
ggcgtcgaggacgcgggcgagtaccacgccgtgctaagcagcgacgagaaggactttggc
gggtttgagaacatctcgatgggcacgacgtaccacaccacgccgatcgagtggaatgga
aggaagaactggatgcatttacaggtctatattccgtcgaggacgtgcttggtgttggcg
aagtga

DBGET integrated database retrieval system