KEGG   Schizophyllum commune: SCHCODRAFT_63953Help
Entry
SCHCODRAFT_63953  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 425 aa AA seqDB search
MARGKWIFGAQQSANQGDPKPGIVAAGPSADARKFGLENFGNTCYANSVIQALYFCTPFR
DLMIQAHDPSAPHTPRLLPNASPPPPLAFIRRKPERKGSVSGPAPADGTPPQSHGALQSA
SSSSPVVYTIPSNPPTLFSALRSLFLHISTNPAEKGTVAPRAFIDKLKEMNELFRSTMHQ
DAHEFLNYLLNKIVEEVEQQARAQPGADDSTLAPTVLTNTASTNSGTPPEDATLVHRLFE
GVLTSETRCLTCETVSSRDECFLDLSIDIEQNSSVTACLRQFSASEMLCQKNKFFCDSCC
ELQEAEKRMKIKKLPNVLALHLKRFKYQEDQQKYVKLAYRVAFPFELRLFNTVDDMDEPD
RLFNLFAIVVHIGAGPHHGHYISIIKTLGTWLVFDDDNVYPISESEIPKYYGDSSAGSAY
VLYYQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagggaaatggatatttggtgcacaacagtctgcaaaccaaggggaccccaag
cccggcatcgtcgccgcagggccctctgcagatgcccgcaaattcggactcgagaatttt
ggcaacacttgctatgccaactcggttatacaggcgctctacttctgcacacccttccgg
gatctcatgatccaggcgcacgacccctcagcaccgcacaccccccggctgctcccaaat
gcatccccgccgccgcctctcgccttcatccgtcgcaagccagagcgcaaaggatcggta
tcaggtcccgcacccgccgacggcacgcccccgcaatcgcatggcgccctccagtcggcg
tcgtcgtcgtccccagtagtctacaccatcccctccaaccctccgacgctcttctccgcc
ctacgctccctcttcctccacatctcgacgaacccggcggagaagggcacggtcgccccg
cgcgccttcatcgacaaactcaaggagatgaacgagctcttccggtcgaccatgcaccaa
gatgcgcacgaattcttgaactatctcctcaacaagatagtcgaggaggttgagcagcag
gcgcgcgcgcagccgggcgcggacgattcgacactagcgcccaccgtccttaccaatacc
gccagcacaaattcgggaacaccacctgaagatgccacgctagttcaccgactcttcgag
ggcgtcctcacgagcgagacccggtgcctaacatgcgagacggtatcatcacgtgacgag
tgtttcctcgacttgtccatagacatcgagcaaaactccagcgtaactgcgtgtcttcgg
cagttcagtgctagcgagatgctctgccaaaagaacaagttcttctgtgactcgtgctgc
gaactgcaagaagcggagaaacggatgaagatcaagaagctaccaaatgttttggcactc
cacctcaagcggttcaagtaccaagaagaccaacaaaagtatgtcaagcttgcttacagg
gtcgcctttcccttcgaactgcgattattcaacaccgtggacgacatggacgagcccgac
cgcttgtttaatttattcgctatcgtcgttcacattggcgctggtccgcaccacggtcat
tacatctcaataatcaagaccctcggcacctggttggttttcgacgatgacaacgtctat
ccaatctcggagtccgaaatacccaaatactacggcgactcaagcgctgggtccgcttac
gtcttgtattatcaa

DBGET integrated database retrieval system