KEGG   Schizophyllum commune: SCHCODRAFT_64068Help
Entry
SCHCODRAFT_64068  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
scm  Schizophyllum commune
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCHCODRAFT_64068
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCHCODRAFT_64068
Enzymes [BR:scm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SCHCODRAFT_64068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 568 aa AA seqDB search
MRFVLSRLPLQRGATSSFLRGRTMSTLPLRPPSADEESALLESRTQEISEFFSSPRFKGI
KRTYTPVDVAKKQGLLPATTLPGTLLADKLHALLSEAANEGRPVHTMGAVDPVQMTQMAA
NQEVVYISGWACSSLLTTGNNEVGPDFGDYPYTTVPNQVHRIFRAQQLHDRKHFDARMSA
TLEQRSKMKYIDYLRPIIADADTGHGGLSAVMKLTKLFAESGASAVHFEDQLHGGKKCGH
LAGKVLVPTSTHTSRLVSARFQLDLLKSTMLTIARTDSESATLISSTVDATDHEFILGTT
KPGLPLAEAIAEAELRGASGPEINDVESAWMLEHELCTFGEAVEKAIAASDISDKASALE
VFKTSSAGKSNTVARDIAADILGKPVFFDWDAPRTREGYHHFRGGIEPAIRRSIQFAPYA
DMIWLETKKPDLEQARSFARRIRAAHPGKWLVYNLSPSFNWAGHGFTEEQLKSFVWDLAK
EGFVLQLISLAGLHSNAVTTAELSKRFKDEGMLAYVNLIQRKEKEIGCDVLTHQKWSGAN
YIDGILQTVSSGSSSSSAIGKDSTEHSF
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcgtactctcgagactgccccttcagcgcggcgcgacgagctccttccttcgt
ggccgcaccatgtcgacgctccctctacgccctccatcagcggacgaggagagtgcactg
ctggaaagcaggacgcaggaaatatcagagttcttcagctcgccgcgattcaaggggatc
aagagaacatacacgcccgttgacgtggccaagaagcagggcttgctccctgcaacgacg
ctgcctggcacgctcctcgcggacaagctgcatgccctgctctccgaggctgctaacgaa
gggcgacctgtgcacacgatgggcgcggtagacccggtgcagatgactcagatggctgcc
aaccaggaagtggtgtacatctcggggtgggcctgcagcagcttgctgaccacggggaac
aatgaagtgggcccggactttggggactacccatatactacagtgcccaaccaggtgcat
aggatcttcagggcccaacagctgcatgaccgcaagcacttcgatgcgcggatgtccgcg
acgctcgagcagaggtcaaaaatgaagtacatcgactaccttcgccccatcatcgcggac
gcggacacagggcatggaggcctgtccgccgtcatgaagctcacaaagctgttcgcagaa
tctggagcgtccgcggtccatttcgaagatcaactacacggcggcaagaagtgtggccat
cttgccggcaaagtcctcgtccctacttccactcacacctctcggctcgtctctgcccgc
ttccagctcgatctcctcaagtccaccatgctcaccatcgcgcgcactgactccgagagc
gcgaccctcatctcgtctactgttgacgcgacggaccacgagttcatcctgggcacgacg
aagcctgggctcccgctggcggaggcgattgcggaggcggagctgaggggcgcgagcgga
ccggagatcaacgatgtagagagcgcctggatgcttgagcatgagctgtgcactttcggg
gaggctgttgagaaggccatcgcggcgtcagatatttccgacaaggccagtgctctcgag
gtgtttaagacctcgtctgctggcaagtccaacaccgttgcgcgcgacattgccgccgac
atccttggcaagcccgtcttctttgactgggatgcccctcgcacccgcgaagggtaccat
cacttccgcggtggcatcgagcctgccattcgccgttccatccagtttgcgccgtacgca
gacatgatctggctggagacgaagaagccggacctagagcaagcgcggtcctttgcgagg
cggattcgcgcggcgcatccggggaagtggctcgtgtataacttgagcccgagcttcaat
tgggcggggcatggatttaccgaggagcagttgaagagcttcgtttgggatctcgcgaag
gaaggcttcgttctgcagctcatctccctggctggcctacacagcaacgctgtgacgacg
gccgagctctcgaagcgattcaaggacgaggggatgctggcgtatgtcaacttaatccag
cgcaaggagaaggagattggctgtgacgtcttgacacaccagaagtggagcggcgccaac
tacatcgacggcatcctgcagacggtgtcctcagggtcgtcgagctcctcggcgattggc
aaggactcgacggagcactccttctag

DBGET integrated database retrieval system