KEGG   Schizophyllum commune: SCHCODRAFT_64312Help
Entry
SCHCODRAFT_64312  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
scm  Schizophyllum commune
Pathway
Regulation of mitophagy - yeast
Insulin resistance
Brite
KEGG Orthology (KO) [BR:scm00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    SCHCODRAFT_64312
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    SCHCODRAFT_64312
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SCHCODRAFT_64312
Protein kinases [BR:scm01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   SCHCODRAFT_64312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2309 aa AA seqDB search
MSSDAAAKLWDENLTKRLFDLIHSTNIVDQTGGLLAIDHLLDVDREETIESKRNLFRFYN
YVKHLLPHHDFHLMLQASKTLGKIAEIGGSAFGEGFMEKEVPAAVDLMQPEKPEAPRYAG
VLILKELARNSSNYFYSHIGMVFDNILVPLRDQRLIVREGAAELLAACLEIITQRERNTR
NSPFLLKILQDAQMGLKQAQPEVIHGSLLTYRELLLHGGMFMRETFLDSAEQILRFKSHR
DGLIRKTVITLVPSLAAYDTTTFTEHFLHKSMAQLLTQLEKPADRPFAFVAIGHTAAAVG
SDMKPFLEPIMGQIKAGLQARGRRNAPPEEPMFQCLGMLASAVGPNLTKLLHDQLDLIFA
CGLSEPLRNALVAIAKHIPPLLKTIQDRLLDLLSMILSGQPYKPLGAPPALERADASAMS
RDINTSQASIVGEKTPEVITLALTTLGSFDFSGHILNEFVRQCALPYLEDDHPEVRRAAA
TTCCRLFVRDPICYQASSHAIEVISDVLDKLLTVGIADPAVDASIRQTVLSSLHERFDKH
LAQAENVRSIFIALNDEVFDNRVTAVTLIGRLAKHNPAYVMPSLRKALIQLLTELEYSTV
VRSREECTRLLTLLVGATQRLIKPYALPMLRVLMVKADDVNPTVSANVLMCLGELACVGG
EDAMAHVPDLMQVILRKLSDPSFLRRDAALHTLGQICTSTGYVISPLIDHPQLLQILARI
LKTETSQTVRREVVKVLGIMGAMNPYRRKVCRPDDDATGEKAITAVNQMPLATQSIVAVS
DDYYQTVVVNALLAILRDQSLSPQHHAVIEAIMSIFKTQGLKCVAFLPQIIPAFAAVTRT
SIARLQEFHLQQLAILVGIIKQHIRNYMPDVFALITDLWENTSLQLPIVSLVEALGRALD
AEFKPFLPNIIPLLLKVVEGELTDKRMSTQMKVFDALQTFGANIEEYLHLVVPVIVKTFE
RPDASTALRKKAMQTIDGLSKRINFSDRASRIIHPLVRVLEGSNNELRMAVMDTLCALVI
QLWSDFAIFVPTINKAMLRNRVTHPNYESLISKLLNGQPIPRGSGHLEPFDTSKPPEFSA
PAEPPNFTVNQQHLKSAWDVSLVSTREDWGEWMHRMSVEFMKESPSHALRACMTLVDTHP
PLARELFNAAFMSCWGELYDQYQEDLVRSIEFAITSTSAPSDLINRLLNLAEFMEHEEKP
LPIDNHTLGEYSMKYLAYAKALHYKELEFFSRSSPSIIEALISINTRLQQHDAAWGTLLR
AREQYDVTKHEEWYERLGRWQEALTVYDNKALTQPNDPEVQLGRMKCLHALGDWDQLAMQ
VQKSWMKADIDLRRAIAPMAAAAAWSLNDWDSMDDYITTMRNDSPDRSFYRAILCVHRNQ
FPKALVNISRARDLLDPELQSFVGEGYGRSYGIMVRAQMLSELEEIIMYKQYADQPDRQT
TMRKTWMKRLQGCQPDVEVWQRILQVRTLVLNPEDDPDMWIKFANLCRKSDRMALAEKTI
RSLLSPRHGHGYDMHHIKAPPNVVYAQLKYMWACGNYDESLQFLREFSAKLEADVKDPRS
TASADKHATSAKLLARCYFKQASWQAQRNEEWHNDETLRQQIMYAYLFATQCDPQWYKAW
HTWALANFEVVGHIESQADTRLSDIPGEILAGHVMQAIRGFFCSISLRNEESLQDTLRLL
TLWFKFGAHQKVSEQMAEGFRTVPIDTWLDVIPQIIARIQTPHINIRRDITHLLTDIGKE
HPQALIYPLTVASSSSSASRSKIAKDIMKKMESHSMEIVQQAKLVSKELIRVAILWHERW
HEGLEEASRLYFTEKNNEGMIACLEPLHEMVENGPETARETSFAQTFGRDLHEAREACNR
YRRTGDPTELEKAWDIYYAVFKKIEKHLPTLIKLDLQYVSPALLEARNLQLSVPGAYQAG
RPVITIAKFAPKLQVIASKQRPRRLSLTGSDGRDYQYILKGHEDLRQDERVMQLFTLVNT
LLSVDTSSFKRRLHIQRYAVIPLAPNAGLIGHLQESDTLHVLVKDYRDSRKVLLNIEYRL
MLQMAPDYENLTLIQKVEVFEYALENTTGQDLYRVLWLKSTNSEHWLERRACYTRSLAVN
SMVGHILGLGDRHPSNILLERSTGKIVHIDFGDCFEVAMHREKFPEKIPFRLTRMLTQAM
EVSGIEGSFRNTCEITMQVLRDNKESLMAVLEAFVYDPLINWRLMQTDVEARRTEDPDRA
VELARVAAHPQGPTRKMMADERDIFSDGVQETRNEKALVVYNRVQHKLTGRDFNPSVTLN
VPQQVEKLIQQATSLENLCQCFSGWCAFW
NT seq 6930 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggatgctgcagcgaagctctgggacgagaatctgacgaaacggctcttcgat
ctcatccacagcacgaacatcgtcgaccagacggggggtttgctggctatagatcacctc
ctcgacgtcgacagagaggaaaccattgagtccaagaggaatctcttccgcttctacaac
tacgtcaagcacctccttccgcaccatgacttccacctcatgctccaggcgtcgaaaacc
ctcggcaagattgctgagatcggcgggtccgccttcggggagggcttcatggagaaggag
gtgccagcggcggtggacctgatgcagccagagaagccagaggccccgcggtacgctggc
gtgcttatcctgaaggaactggcgcgcaactcctcgaactacttttattcccacatcggc
atggtctttgacaacatcctggtgccgctaagggatcagcgcctcatcgtgcgcgagggg
gcggcggagcttctggctgcatgcctcgaaatcattacacagcgcgagcggaacacgcgc
aatagccctttcctcctcaagatcctccaggacgcgcagatggggctgaagcaagcccag
cctgaagtgatccacgggtctctgctcacctatcgcgagcttttgctgcacggtggcatg
ttcatgcgagaaacgttcctcgattcggcggagcagatccttcgcttcaagtcgcatcgc
gacgggcttatccgcaagaccgtcatcaccctcgtcccgtctttggcggcgtacgacacg
accacattcacggaacacttcctgcacaagtccatggcacagctcctcacgcagctcgag
aagcccgcggatagacccttcgcttttgttgccatcgggcataccgcggcggcagtgggc
agcgacatgaagccgttcttggagcccataatggggcagatcaaggcggggctgcaggcg
cgaggaagaaggaatgcgccacccgaggaaccgatgttccaatgcttgggcatgctggcg
tctgccgttgggccgaatctgacgaagttgttgcacgatcagcttgacctgatctttgcg
tgtgggcttagtgagccgctgcgtaacgcgctggtcgctattgcgaagcatatccctccc
cttctcaagacgatccaagaccgtttgcttgatcttctgtcaatgatcctgagcggtcag
ccatacaagccattgggcgcgcctccggcattggaacgggcggacgcaagcgcaatgtcg
cgagatatcaacacctctcaggcgtcgatagttggggagaagacaccggaggtcatcacg
cttgccttgacaaccttgggttcctttgacttcagcgggcatattctgaacgaattcgtg
cggcaatgcgccttgccatatctcgaagacgaccacccggaagtgcggcgtgcggcggct
acgacgtgttgcaggctcttcgtccgcgaccccatctgctatcaagctagcagccacgcc
atcgaggtcatcagcgacgttctggataagctgttgactgtcggcatcgcagatcctgcg
gtagatgcatccatacgccaaacggtcttatcgtccctgcacgagcgcttcgacaagcat
ttggctcaagcggagaacgtgcgctccatcttcatcgcgctcaacgacgaggtgttcgac
aatcgcgtcaccgctgtgactctcattggacgtctagccaagcacaaccccgcctacgta
atgccgtctctgcgcaaagctctcatccagctattgaccgagttggaatattcgaccgtc
gtccgaagcagggaagaatgcactcggctcctgactctcctcgtcggggcgacgcagcgg
ctcatcaagccgtacgccttgccaatgcttcgcgtgctcatggtcaaggctgacgatgta
aacccgaccgtgtcggccaacgtcctcatgtgcctaggagagcttgcttgtgttggcggt
gaagacgcgatggcgcatgtacccgaccttatgcaagtgatcctcaggaaactatcggac
ccctccttcctccggcgcgatgctgcgttgcatactctcggccagatctgcacgagcacc
ggctacgttatcagccctctgatcgaccacccgcaattgcttcagattctggcgcggatc
ctcaagacggaaacctcgcagaccgtacgtcgtgaagtcgtgaaggttcttggtatcatg
ggcgccatgaacccgtaccgccgaaaggtatgtcgcccagatgacgacgctacgggcgag
aaggcgatcaccgccgtcaaccagatgcctcttgcgacgcagtccatcgtggctgtgtct
gacgactactaccagacagtggtcgtcaacgcgctccttgctatcttgcgtgaccaatcg
ctgagccctcagcatcacgcggtcatagaggcaattatgtcgatcttcaagacgcagggc
ctcaaatgcgtggcgtttctccctcagatcatccctgccttcgctgctgtgaccaggacg
tcgatagcgcgtttgcaagaatttcacctgcaacaactcgccatcttggtcgggatcatc
aagcagcatatccggaactacatgccggacgtctttgccctcatcacggatctttgggaa
aatacatcgctgcaactaccgatcgtctccctcgtcgaggctttgggtcgtgcattggac
gccgagttcaagcctttcctcccgaatatcatacccttgcttctcaaggtcgtcgagggc
gagctcacggacaagcgcatgagcacgcagatgaaggtcttcgacgccttgcagacattc
ggtgccaacatcgaggagtatctccaccttgtcgtgcccgtgatcgtcaagaccttcgag
agaccagatgcgagcacggcgttgcgcaagaaggccatgcagacgatcgacggactgtcg
aagcgcatcaatttctccgatagggcgtctcgaatcattcatcccctggttcgggtgttg
gaggggtcgaacaacgagctgaggatggcggtcatggacacgctatgcgcgctggtcatt
caactatggtcggacttcgccatattcgtgccaaccatcaacaaggccatgttgcgcaac
cgtgtaacgcatccgaactatgagagtctcatcagcaagcttctcaacggtcaacccatc
cctcgagggtctgggcatctcgaaccctttgacaccagtaaacctcccgaattctcggcg
ccagcagagccgcccaacttcactgtcaaccaacagcatttgaagtcggcttgggatgta
tcgctcgtgtcaacccgagaggactggggtgaatggatgcatcgcatgagcgtcgagttc
atgaaggagtcaccgtcgcacgctctgcgcgcttgcatgacgctggtcgatacccaccct
ccgcttgccagggagcttttcaacgccgctttcatgtcgtgttggggcgaattgtacgac
cagtaccaggaggatttggttcgttcaatagagttcgctatcacctcgacatcggcaccg
tccgacttgatcaaccgccttctcaatctggctgaattcatggagcacgaagagaagcct
ctgcccatcgacaatcatacgttgggcgagtactccatgaagtacctcgcgtacgcaaag
gccctccattacaaggagctcgagttcttctctcggtcgtcgccgtcaatcatcgaggcc
cttatctctatcaacactcgcttgcaacagcacgacgccgcatggggtaccctccttcga
gcgcgcgaacaatacgatgtcaccaagcacgaagagtggtacgagaggctgggcagatgg
caggaagccttgacggtgtacgacaacaaggctctaactcagccaaacgatcctgaagtg
cagcttggtcggatgaagtgtctacatgcccttggcgactgggaccagctggctatgcaa
gtgcaaaagtcctggatgaaggcggacatcgacctgcgtcgtgcgattgcgccaatggca
gctgcggcggcctggtccttgaatgattgggattccatggacgactacatcaccacgatg
cgtaacgattctccagatcgctccttctacagagcaatcctctgtgtgcatcgcaatcag
ttccccaaggcccttgtcaacatttcgcgcgcgcgagatcttttggatcccgagctgcag
tcgttcgtcggcgaaggctatggtcggtcatacgggatcatggttcgggcacagatgctc
tccgagctcgaagagattatcatgtacaagcaatacgctgatcagcccgaccgtcaaacc
accatgaggaagacttggatgaagaggttgcagggttgtcaacccgacgtcgaagtgtgg
cagaggatactgcaagtccgtacactcgtcttgaatcccgaggacgacccggatatgtgg
atcaagttcgccaacctatgccgcaagagcgatcgcatggcgcttgctgagaagaccata
cgttcgcttctctcccctaggcatggacatggctacgacatgcaccacatcaaggcacct
ccgaatgtcgtttacgctcagctcaagtatatgtgggcgtgtggaaactacgacgaaagc
ttgcagttccttcgcgagttctctgccaagttggaggccgacgtcaaggacccacgttcg
actgcgtctgcagacaagcacgccacctcagccaagctgctcgcgcgttgctacttcaag
caggcatcatggcaagcgcagcgcaatgaggaatggcataacgacgagactttaaggcaa
caaatcatgtacgcctacctattcgcgacgcaatgcgatccgcagtggtacaaggcgtgg
cacacatgggctctggcgaactttgaagtggtgggccacattgagagccaagcggacacg
cgattgtcggatatcccaggggaaattctcgccggtcatgtcatgcaggccatccgaggc
ttcttctgttcgatctccttgcgaaacgaggagtccttgcaggacactctgcggctgctt
accctatggttcaagtttggtgctcaccagaaggtcagcgagcagatggcggagggtttc
aggacagtccccatcgacacatggctggacgtcatcccgcagatcattgcgcgcatccag
acaccgcacatcaacatccggagggacatcactcatcttctgactgacattggaaaggag
cacccgcaggcgttgatctacccgctcactgtcgcttcgtcgtcctcaagcgcttctcgt
tcaaagatcgctaaggacatcatgaagaagatggagtcgcacagcatggagatcgttcaa
caggcgaagcttgtcagcaaggagctcatccgcgtcgccatcctttggcatgagaggtgg
cacgaaggtcttgaggaggcttcgcgactatacttcacggagaagaacaacgagggcatg
atcgcctgcttggagcccttgcacgagatggttgagaatggccccgagaccgcgagggaa
acgtcgtttgcccagactttcggccgcgatctgcacgaagctcgggaggcatgcaacagg
tacaggaggacgggcgaccctacggagctggagaaggcatgggatatctactacgcggtc
ttcaagaagatcgagaagcacttgccgacgttgatcaagctcgacctgcaatacgtctct
ccggcgttgctagaagcccgcaatctacaattgtccgtgccaggcgcataccaagcaggc
cggccggtcattactatcgccaagttcgcgccgaagctgcaggtcatcgcatcgaagcaa
cgcccgagacgattgtccttgactggcagcgatggacgagactaccaatacatcttgaag
ggccacgaggatctccgccaagacgagcgcgtcatgcaactgttcaccctcgtcaacacc
ctcctctccgtcgacaccagcagcttcaagcgccgattgcacatccaacgctacgccgtc
atcccccttgcccccaacgccggtcttatcggccatctccaagagagcgacacgcttcac
gtcctcgtcaaggactaccgcgactcgcgcaaagtcctgctcaacatcgagtaccgcctc
atgctgcagatggcgcccgactacgagaacttgacgctcatccagaaggtcgaggtcttc
gagtacgcgctcgagaacacgaccgggcaggatctgtaccgcgtcctctggctgaagagc
acgaactcggagcactggctggagcgaagggcatgctacacgcgctcgctcgcggtgaac
agcatggtggggcatatactgggtctgggcgaccggcatccgtcgaatatcctcctcgag
cggagcacgggcaagatcgtgcacatcgatttcggtgactgtttcgaggttgcgatgcat
cgcgagaagttcccggagaaaattccgttccggttgacgaggatgttgacgcaggcgatg
gaggtcagcggcatcgagggcagcttccgcaatacgtgcgagatcacgatgcaagtgctg
cgcgacaacaaggagtcgctcatggccgtcctggaggcgttcgtgtacgacccgctcatc
aactggaggttgatgcagaccgacgtcgaggcacggcggaccgaagaccccgaccgcgcc
gttgagctcgcgcgcgtcgccgcgcacccgcagggcccgacgaggaagatgatggccgac
gagcgcgacatcttctccgacggtgtgcaggagacgcgcaacgaaaaggcgctcgtggtg
tacaaccgcgtccagcacaagcttacgggcagggacttcaacccctcggtgacgctgaac
gtcccgcagcaggtggagaagctgatccagcaggcgacgtcgctggagaacctctgccag
tgcttctcgggctggtgtgcgttctggtga

DBGET integrated database retrieval system