KEGG   Schizophyllum commune: SCHCODRAFT_64651Help
Entry
SCHCODRAFT_64651  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
scm  Schizophyllum commune
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCHCODRAFT_64651
Enzymes [BR:scm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SCHCODRAFT_64651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 415 aa AA seqDB search
MRLATKLSVLALSTAGALAHLHEQERLGIELDELVKLKTEGGLLANVVGEDAKRPSRWLE
KYGPQYDQPFSGPLSFSHLPYHTCLEQEALDYDIAIIGMPFDTGVTYRNGARFGPYAIRS
GSRRQRASREGYSMAWGLNPYESGLKIIDCGDVPVSPFDNALAVDQLEVAYNTLVGRKTT
HLTGAQPLGKDGAEHPRIVSLGGDHTIVLPILRSLYRTYGPISVIHFDAHLDTWPAYAGT
TSPQSRVTHGTFFYLAQEEGLMSNTSIHAGIRCKMNGIEDLENDASVGFKLVSADDIDDL
GIPEVIKRIRERVGDSPVYLSLDIDVIDPGLAPATGTPEAGGWTTREVKRIIRGLAGLNF
VGADVVEVSPAYDHAEITGIAAADIVHDFLSMMMAPVVPEGGYPYASERQISDEL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctagctacgaagctctcggtgctcgcgctctccactgcaggggctcttgcgcac
cttcatgaacaagaacgcctcggtatcgagctcgacgagctggtcaagctcaagactgag
ggtggccttcttgccaatgtcgtcggcgaggatgccaagaggccgtctcgctggctagag
aagtatggtcctcagtacgatcagcccttcagcggccctttgtcgttctcgcacctgcct
taccatacttgcctcgagcaagaggcgctggactacgatattgccatcattggcatgcct
ttcgacactggcgtcacctacagaaatggagcccgctttgggccatatgctatccgctcg
ggcagccgcaggcagcgcgcctcgcgggaaggctattccatggcatggggtctgaacccg
tacgagtcaggattgaagattattgattgcggagacgtcccggtttctccattcgacaat
gcacttgctgtggaccagctggaggtcgcctataacactttggtagggcggaagaccacg
catctcactggtgcgcaaccgctcggcaaggatggcgcggagcatccgcgaattgtcagc
ttgggtggcgaccacacgatcgtactccccatcttgcgatccttgtacaggacgtacgga
ccaatctccgtcatccacttcgacgctcatctggacacttggccagcctatgctggcacg
acttcgcctcagtcgcgcgtcacccacggcacattcttctacctcgcacaggaggaaggc
ttgatgtcaaacactagcatccacgccggtatccggtgcaagatgaatggaattgaggac
ttggagaacgacgcttctgttggcttcaagctggtctccgccgacgatattgatgactta
ggtatccctgaggtaatcaagcgtatacgcgagcgtgttggggactcgcctgtgtatctg
agccttgacatcgacgttatcgaccctggacttgctcctgcaactggtacgccagaggcc
gggggctggacgacccgcgaggtcaaacgtatcattcgtggccttgctgggctcaacttc
gtcggcgccgacgtcgtcgaggtttcccccgcttacgaccacgccgagatcaccggaatt
gcggcggcagacattgttcacgatttcctctcgatgatgatggcgcctgtcgtaccggag
ggcggatatccctacgcgagcgaacgtcagatctctgacgagttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system