KEGG   Schizophyllum commune: SCHCODRAFT_65071Help
Entry
SCHCODRAFT_65071  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
scm  Schizophyllum commune
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SCHCODRAFT_65071
Translation factors [BR:scm03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SCHCODRAFT_65071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 730 aa AA seqDB search
MPGLTKDINDDDIDYSDIEAKYQVEYDEGLDNIVVVDGAPVIDASKKERLVTKICKDFGK
KGVHVKADNIFMPWDDKAGKSKGYIFIEFRNAEEAAMAIAILNNHAFDSKHTFKLNLFTD
IERFANLDETYVEPKTEEYQPREHLRAWLADGRDQYVTNRGDDVEIHWHGKREQCEIAHK
PMFKEPFLYVAWSPLGTFLVTLHRPGVRLWGGNSWKPQQRFAHPLVKLIDFSPCENYLVT
WSNEPITIPEGAPQGPQFLSPDDEGNNIAVWDIKSGHLLRTFPSVEADAAGKKQMPWPIL
KWSPDDKFVGRVTPGQMISVYELPSMGLHGKKSMKIEGVVDFEWCPQGDKDKEDADKDAK
AAASGGKTGAKKARDNMLVYWTPEVQNQPARVTLISFPSRTILRQKNLFNVSECKLYWQN
QGDFLCVKVDRHTKTKKSIFCNLEIFRVREKDYPVEVVELKDTVTDFSWEPKGERFAIIS
TSDPNLGNPGPGVTIKTDVSFYQLDRTKNDFKLLKTLSGRTSNAIRWSPRGRHVVLATVG
SSTKSELEFWDLDFNNEDRPAGSSNEWGSGIQLLGTADHYGVTDVEWDPSGRYLATSASA
WSHTLENGYAIWDFRGQELEKHILDRFKQFIWRPRPRTLLTREQQKQIRRNLREYSAQFE
QEDAEARSNVSAELIAQRRRLVDEWNAWRQQCKAELKALGAKEEGKEEEAKEEIEVWIEE
VIEQTEEVIE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgccaggccttacaaaagatataaacgacgacgacatcgattactcggacatcgaggcc
aagtaccaggtcgagtacgacgagggcttggataacatcgtcgtcgtcgatggcgccccc
gtgatcgacgcctccaagaaggagcgtctagtgaccaagatatgcaaggattttggtaaa
aagggcgtgcacgttaaggccgacaacatcttcatgccatgggacgacaaggcgggcaag
agcaaaggctacatcttcatcgagttccgcaacgccgaggaggccgcgatggccatcgcg
atcctgaacaaccacgcattcgattcgaagcatactttcaagctcaacctcttcaccgac
atcgagcgcttcgcgaaccttgatgagacgtacgtcgagccgaagacggaggagtaccaa
ccaagagaacacctgcgcgcctggcttgctgacggacgcgatcaatacgtgacaaaccgc
ggcgacgatgtcgaaattcactggcacggcaagcgggagcaatgcgagattgcgcacaag
cctatgtttaaagaacccttcctctacgttgcctggtcccccctcggcaccttcctcgtc
acccttcatcgccccggcgtgcggttgtggggcggcaactcttggaagccgcagcagcgt
ttcgcccacccgctcgtcaagctcatcgacttctcaccttgcgaaaactacctcgtcacc
tggtcgaacgagccgatcaccattcccgagggcgcacctcagggcccgcagttcctctcg
cccgacgacgagggcaacaacatcgccgtctgggacatcaagtccggccacctcctccgc
accttcccctccgtcgaggccgatgccgctggcaagaagcagatgccgtggccgattctg
aagtggagtcccgacgacaagttcgtcggccgtgtaacacctgggcagatgatcagtgtc
tacgaattgccgagtatgggtcttcacggaaagaagagcatgaagatcgagggtgtcgtc
gacttcgagtggtgtccgcagggtgacaaggacaaggaggatgcggacaaggacgcgaag
gcggcggcgtcgggtggaaagacgggcgcgaagaaggcacgggacaacatgctcgtgtac
tggacgcctgaagtgcagaatcagcccgcacgcgtaactttgatcagcttcccgagccgg
accatattgcggcaaaagaacttgtttaacgtgtccgagtgtaaactttactggcaaaat
cagggcgacttcctttgcgtcaaggtcgataggcatacgaagaccaaaaagtcgatcttt
tgcaacctcgagatcttccgcgtacgcgagaaggactaccctgtcgaggtcgtcgagctc
aaggacactgtcactgacttctcctgggagccgaagggcgagcgcttcgccatcatctcc
acctccgaccccaaccttggcaacccgggcccgggtgtcaccatcaagaccgacgtctcg
ttctaccagctcgaccgcacaaagaatgacttcaagctgctcaagacgctctccggccgc
accagcaacgccatccgctggtcaccgcgcggtcgccacgtcgtccttgccaccgtcggc
tcctccaccaagtccgagctcgagttctgggacctcgacttcaacaacgaggaccgcccc
gcgggttcgtcaaacgagtggggctccggcatccagctgctcggcaccgccgaccactac
ggcgtcaccgacgtcgagtgggatcccagcggtcgctacctcgccacgagcgcctccgcc
tggtcgcacacgctcgagaacgggtacgcgatctgggacttccgcgggcaggagctcgag
aagcacatcctcgaccgcttcaagcagttcatctggcgcccgcgcccgcgcacgctgctc
acgcgcgagcagcagaagcagatccgccggaacctgcgcgagtacagcgcgcagttcgag
caggaggacgcggaggcgcgcagcaacgtgtcggcggagctcatcgcgcagcgcaggcgg
ctggtcgacgagtggaacgcgtggcggcagcagtgcaaggcggagctgaaggcgctcggc
gcgaaggaggagggcaaggaggaggaggcgaaggaggagatcgaggtgtggatcgaggag
gtcatcgagcagacggaagaggtgatcgagtga

DBGET integrated database retrieval system