KEGG   Schizophyllum commune: SCHCODRAFT_65574Help
Entry
SCHCODRAFT_65574  CDS       T01331                                 

Gene name
pkac1
Definition
cAMP-dependent protein kinase A catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
scm  Schizophyllum commune
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:scm00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SCHCODRAFT_65574 (pkac1)
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SCHCODRAFT_65574 (pkac1)
Protein kinases [BR:scm01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   SCHCODRAFT_65574 (pkac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 432 aa AA seqDB search
MSGAATNTRPSLANAAPRLGSISLPRRESQVVPDAPITPPLSPGHSELSIDDVEMVDRVL
PSPGPAHHQLHQPTQHDMQVDEERPQPPLRLLEDEKVHLQKVGIKLTDFEVRGTLGTGTF
ARVLIVRHRGRESNNYFAMKVLRKSEIVRLRQVEHVNAERYILSRIQHPFIVDLFATFQD
SLNVYMLMSYVPGGELFTHLRRAQRFTPDVTRFYLATIILALRYLHSFNIIYRDLKPENL
LLDSRGYLRLTDFGFAKIVDDRTWTLCGTPEYLAPEIIQSDGHGKAADWWAVGVLCYEML
VGYPPFFDESPYGIYEKILDGHIHWPRSMDPLSRSLIRAFLNPDRTKRLGNMIGGPQDVL
EHPWFRGVDWDALERREIMAPIIPHTSSGDDTRHFLRLPLPPAEDMPGLFHEEQPPALEQ
RFDPTAYQFLEF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgcggcgaccaacacgcgcccctccctcgcgaacgccgctcctcgcttgggc
tccatctcgctccctagacgggaatctcaggtcgtgcctgacgcacctatcactccgccc
ctttcccccggacacagcgagctcagcatcgacgacgtagagatggttgatcgcgtactt
ccatcccccggaccggcacaccaccaactccatcagcccacccagcatgatatgcaggtc
gacgaggagcggcctcagccccccctccgcctgcttgaagacgaaaaggtgcatctgcaa
aaagtcggcatcaagctcacggacttcgaggttcgggggacccttggtacgggcacgttt
gcccgcgttctcatcgtccgacatagggggcgcgagtccaacaactacttcgcgatgaag
gtcctccgcaagagcgagatcgtgcgcctgcgccaagtggagcatgtgaacgcggagcgc
tacatcctctcccgcatccagcaccccttcatcgtcgacctcttcgccaccttccaggac
agcctgaatgtctacatgctcatgtcctacgtccccggcggtgagctcttcacccacctc
cgccgcgcccagcgcttcacccccgacgtcacgcgcttctacctcgccaccatcatcctc
gccctccgctaccttcactccttcaacatcatctaccgcgacctgaagcccgagaacctc
ctcctcgactcgcgtggctacctgcgcctcaccgacttcggcttcgcgaaaatcgtcgac
gaccgcacgtggacactctgtggtacgccagagtacctcgccccggagatcatccagtcc
gacggtcacggcaaggctgcagattggtgggccgtcggcgtgctctgctacgaaatgctt
gtcggttatccccctttcttcgatgaatcgccgtacgggatatacgagaagatcctcgac
ggacatatccattggccgcgtagcatggatccgctgtcgagaagcctcatccgcgccttt
ttgaaccccgaccgcaccaagcgactgggtaacatgattggcgggccacaagacgtcctg
gagcacccgtggttccgaggtgtagattgggacgctttggagcgaagagagatcatggcg
ccgataattccacatacttcctccggcgacgatactcgacatttcctacgcctgccgctc
ccgcccgcagaagacatgccaggcctcttccacgaggagcaaccgcccgcgctcgaacag
cgcttcgatcccactgcatatcagttcctcgagttctga

DBGET integrated database retrieval system