KEGG   Schizophyllum commune: SCHCODRAFT_65574Help
Entry
SCHCODRAFT_65574  CDS       T01331                                 

Gene name
pkac1
Definition
(RefSeq) cAMP-dependent protein kinase A catalytic subunit
Organism
scm  Schizophyllum commune
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 432 aa AA seqDB search
MSGAATNTRPSLANAAPRLGSISLPRRESQVVPDAPITPPLSPGHSELSIDDVEMVDRVL
PSPGPAHHQLHQPTQHDMQVDEERPQPPLRLLEDEKVHLQKVGIKLTDFEVRGTLGTGTF
ARVLIVRHRGRESNNYFAMKVLRKSEIVRLRQVEHVNAERYILSRIQHPFIVDLFATFQD
SLNVYMLMSYVPGGELFTHLRRAQRFTPDVTRFYLATIILALRYLHSFNIIYRDLKPENL
LLDSRGYLRLTDFGFAKIVDDRTWTLCGTPEYLAPEIIQSDGHGKAADWWAVGVLCYEML
VGYPPFFDESPYGIYEKILDGHIHWPRSMDPLSRSLIRAFLNPDRTKRLGNMIGGPQDVL
EHPWFRGVDWDALERREIMAPIIPHTSSGDDTRHFLRLPLPPAEDMPGLFHEEQPPALEQ
RFDPTAYQFLEF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgcggcgaccaacacgcgcccctccctcgcgaacgccgctcctcgcttgggc
tccatctcgctccctagacgggaatctcaggtcgtgcctgacgcacctatcactccgccc
ctttcccccggacacagcgagctcagcatcgacgacgtagagatggttgatcgcgtactt
ccatcccccggaccggcacaccaccaactccatcagcccacccagcatgatatgcaggtc
gacgaggagcggcctcagccccccctccgcctgcttgaagacgaaaaggtgcatctgcaa
aaagtcggcatcaagctcacggacttcgaggttcgggggacccttggtacgggcacgttt
gcccgcgttctcatcgtccgacatagggggcgcgagtccaacaactacttcgcgatgaag
gtcctccgcaagagcgagatcgtgcgcctgcgccaagtggagcatgtgaacgcggagcgc
tacatcctctcccgcatccagcaccccttcatcgtcgacctcttcgccaccttccaggac
agcctgaatgtctacatgctcatgtcctacgtccccggcggtgagctcttcacccacctc
cgccgcgcccagcgcttcacccccgacgtcacgcgcttctacctcgccaccatcatcctc
gccctccgctaccttcactccttcaacatcatctaccgcgacctgaagcccgagaacctc
ctcctcgactcgcgtggctacctgcgcctcaccgacttcggcttcgcgaaaatcgtcgac
gaccgcacgtggacactctgtggtacgccagagtacctcgccccggagatcatccagtcc
gacggtcacggcaaggctgcagattggtgggccgtcggcgtgctctgctacgaaatgctt
gtcggttatccccctttcttcgatgaatcgccgtacgggatatacgagaagatcctcgac
ggacatatccattggccgcgtagcatggatccgctgtcgagaagcctcatccgcgccttt
ttgaaccccgaccgcaccaagcgactgggtaacatgattggcgggccacaagacgtcctg
gagcacccgtggttccgaggtgtagattgggacgctttggagcgaagagagatcatggcg
ccgataattccacatacttcctccggcgacgatactcgacatttcctacgcctgccgctc
ccgcccgcagaagacatgccaggcctcttccacgaggagcaaccgcccgcgctcgaacag
cgcttcgatcccactgcatatcagttcctcgagttctga

DBGET integrated database retrieval system