KEGG   Schizophyllum commune: SCHCODRAFT_66151Help
Entry
SCHCODRAFT_66151  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
scm  Schizophyllum commune
Brite
Exosome [BR:scm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCHCODRAFT_66151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 147 aa AA seqDB search
MAPKPASTAGKAPASTASKAPAKPESSKAAKKTASKSKAAAPADGEKKKRKKTRKETYSS
YIYKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLAAYSKKSTISSREIQTSVR
LILPGELAKHAISEGTKSVTKFSAGAK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaaacccgcatccaccgcaggcaaggccccggcctccaccgcgtccaaggcg
cccgctaagcctgagagctccaaggctgccaagaagacggcgagcaagagcaaggccgcc
gccccagccgatggcgagaagaagaagcgcaagaagacccgcaaggagacatacagctcc
tacatctacaaggtgctcaagcaggtccaccctgacactggtatctccaacaaggcgatg
gccatcctgaactccttcgtcaacgatatcttcgagcgtatcgccactgaggcatccaag
cttgcggcgtactcgaagaagtcgaccatctcgtcccgcgagatccagacctctgtccgc
ctcatcttgcctggtgaactcgccaagcacgctatctccgagggaacgaagtccgtgact
aagttctccgcgggcgcgaagtag

DBGET integrated database retrieval system