KEGG   Schizophyllum commune: SCHCODRAFT_66334Help
Entry
SCHCODRAFT_66334  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SCHCODRAFT_66334
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     SCHCODRAFT_66334
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     SCHCODRAFT_66334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 698 aa AA seqDB search
MESKVLVIYTGGTIGMLTGAHGFVPEPAFLTQTLRSQARFHDPLQDSLFSHAASVEGFRT
WSGRASPVQPSPPQSPTSANARALDGPTLRVRSKRPIVGAAPTPPQKRVKPDTRDQAEAG
EDLRRDDNGKQDEDDDGYYEAHLPSLLMPATVVSSGAVRKAMRYAIMEWHPLLDSSNIEM
KDWIRIATEIELNYNLYDAFVILHGTDTMSYTSSALSFLLEDLGKTVILTGAQIPLSQLR
NDATDNLMGALLTAGHYTIPECCLYFNHTLYRGNRVTKVSSDELAAFDSPNFAPLVKVGI
DIVVNWNDVIRQTSLRRFKAHKDLSSKVVTIRLFPGITAAMISVFCAPPVQGVVLEAFGA
GNAPNRQDLLQAIRDACDRGVVIVAISQCTKGSVSAAYETGIALVKAGVVPGYDMSPECA
LTKLSYLLSKPELSPAAVRELIRTPLRGELTRPEGAPAIAGEPGGLAGTLENVQRALGHF
ARLARPGGALPAVTVTADADADGRDTKDAGAPWSWTAAEAGATEAVLVPSLVHLAAACGD
AECLRFCLAEAGARLPDEDSPIPKDEDVHAAQSAHYTPQVPQYGTTGAGLANALEPGVGR
TPLHVAALNGHGQMVDALLHAGALVHLRDALGHTALYYAARQGHGEVVRLLVQAGATLGG
TDDMFAEVSVKVAQKQGDQHALNVWVMAGVPVREESQM
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggagtccaaagttctcgtcatctacaccggtggcacaatcggtatgctcactggcgcg
cacggattcgtgcccgaacccgccttcctgacgcagactctacggagccaggcgcgcttc
cacgacccgcttcaagactcgctattctcgcacgcagcaagcgtcgaaggcttccgaaca
tggagcgggcgcgcatcgcccgtgcagccgtctccaccccaatcgccaacatctgccaac
gcccgcgcgcttgacggccccacccttcgcgtgcggtcgaagaggccgatcgtcggcgcg
gcgcccacgccgccgcagaagagagtgaagccagacacgagggaccaagcggaggcgggc
gaagatctcaggagagatgacaacggcaagcaagacgaggacgacgacggctactacgaa
gcgcatcttcccagtctgctcatgcctgcgacggtggtctcgagcggggcggtgcgcaag
gcgatgcgttatgcgattatggagtggcacccgctgctggacagcagtaatatcgagatg
aaagactggatccgcatcgcgacagagatcgagctgaactacaatctctacgacgcgttc
gttattctgcacggcacagacacgatgtcgtatacttcgagtgcgctcagctttttgctt
gaagatctagggaagacggtgatcctgaccggcgcacaaatcccattatcccagctacgg
aatgacgcgacagacaatctgatgggtgctctgctgacggcaggtcattataccattccg
gaatgctgcctctacttcaaccataccctatatcgcggcaatcgcgttacgaaggtctcc
tctgatgagctcgctgcttttgacagcccgaattttgcgcctttggtcaaagttggcatc
gatatcgtcgtcaactggaatgacgtgatccggcagacgagcctgaggcggttcaaggct
cacaaggatctcagctcgaaagtcgtcaccatccgcctcttccccggcatcaccgctgcc
atgatctccgtcttctgcgctccgcccgtccagggcgtcgtcctcgaggccttcggcgcc
ggcaacgcgcccaatcggcaggatttgctgcaggcgatccgtgatgcttgcgaccgtggt
gtggtcatcgtggcgatctcgcagtgcacgaagggttcggtgagcgcggcgtatgaaacg
gggatcgcgctggtgaaggcgggggtggtgccgggatatgatatgtctccagagtgtgct
ctaaccaagctcagttacctcttgtcgaaacccgagctctcccctgccgctgtccgggag
ctgatccgtacacctcttcgtggtgaactcacccggcctgaaggcgcgcctgccatagct
ggcgaaccaggagggctggcgggtacgctcgagaacgtgcaacgcgccctcgggcacttt
gcgagactagctcgaccaggtggagcgttgcctgcggtaactgtaacggccgacgccgat
gcggatggtcgggacacgaaggacgcaggcgcgccatggtcttggacagcagcagaagcg
ggcgcgacggaggcagtcctcgtgccctccctcgtccacctagccgccgcatgcggagac
gccgagtgcctgcgcttctgcctcgcagaggcgggggcgcggctccccgacgaggactcg
ccgatcccgaaagacgaggacgtgcacgccgcgcagagcgcgcactacacgccgcaggtg
ccccagtacggcacgacgggcgcgggactggcgaacgcgctggagccgggcgtggggcgg
acgccgctgcatgttgccgcgctgaatgggcatgggcagatggtggacgctctgctgcac
gcgggggcgttggtgcatttgcgagacgctctcggacatacggcgctgtactacgccgcg
cgtcaagggcacggtgaagttgtgcgactactggtacaggcgggggcaacgctgggagga
acggatgatatgttcgctgaggtatccgtgaaggtggcgcaaaagcaaggagaccagcac
gctctcaacgtctgggtaatggcaggggtaccggtacgggaggaaagccagatgtga

DBGET integrated database retrieval system