KEGG   Schizophyllum commune: SCHCODRAFT_66397Help
Entry
SCHCODRAFT_66397  CDS       T01331                                 

Definition
carbohydrate esterase family 8 protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
scm  Schizophyllum commune
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCHCODRAFT_66397
   00500 Starch and sucrose metabolism
    SCHCODRAFT_66397
Enzymes [BR:scm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SCHCODRAFT_66397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 325 aa AA seqDB search
MRLLPFASVSLFPCSFVLAASRTDPPSGAVVVPDDYSTIQAAVDSLGDSEDAVIFIYGGT
YNEQVYIERNGALTIYGETEDTSDYKGNKVTITNSLDASAAGSNDASGTLRVHSDNVAIY
NIDIVNSYGKGSQAIAVSQYGSQVGFYGCGLYGYQDTLLANVGTQVYLKSYIEGATDFIF
GQQAQAYFGGNTLAVSGKGWITAHGRQSDDDGSYVFNKNTIVLADGADSNTEGNFYLGRP
WREYAKVIFMNTDVQAKINPALWSIWNEGDERTGHVTFADYATTGSGISSISRPSFATEL
SSESYSISTAVGSDYANWVDAEYFV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccttcccttcgcttcggttagtctctttccatgttcctttgtcctcgccgcg
tcgcggacggacccgccctcgggcgccgtggttgttccggacgactactcgaccatccag
gctgcggtggactcgctcggcgactctgaggatgccgtgatcttcatctacggcggcacc
tacaacgagcaggtgtacatcgagaggaatggcgcgcttaccatctacggcgagaccgaa
gacacgtcggactacaagggtaacaaggtcactatcacgaacagcctcgacgcaagcgcg
gcggggtccaacgacgcgagtggcaccttgcgcgtacacagtgataatgtcgccatctac
aacattgacatcgtcaattcgtacggcaagggctcgcaggctatcgctgtcagtcagtat
ggtagccaagtgggattctacgggtgtggcttgtacgggtaccaggatacgctgctcgcg
aacgttggcacgcaggtctacctgaagagctacatcgagggcgcaacagacttcatcttc
ggtcagcaagctcaggcatacttcggcgggaacacgcttgctgtaagcggcaagggctgg
atcaccgctcatggaaggcagtccgatgatgacggcagctacgtcttcaacaagaacaca
attgttctcgccgatggtgccgactccaacacggagggcaacttctaccttggtcgtcct
tggagagagtatgcgaaggtcatcttcatgaacaccgacgttcaagccaagatcaacccc
gccctctggtccatctggaacgaaggcgacgagcgcaccgggcacgtcaccttcgccgac
tacgccaccaccggcagcggcatctcctccatctcgcgcccttcattcgccaccgagctc
agcagcgagtcgtactcgatctcgacggcggtgggcagcgactacgcgaactgggtcgat
gcggagtacttcgtttga

DBGET integrated database retrieval system