KEGG   Schizophyllum commune: SCHCODRAFT_66483Help
Entry
SCHCODRAFT_66483  CDS       T01331                                 

Definition
(RefSeq) glycoside hydrolase family 20 protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
scm  Schizophyllum commune
Pathway
scm00511  Other glycan degradation
scm00513  Various types of N-glycan biosynthesis
scm00520  Amino sugar and nucleotide sugar metabolism
scm00531  Glycosaminoglycan degradation
scm00603  Glycosphingolipid biosynthesis - globo and isoglobo series
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCHCODRAFT_66483
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    SCHCODRAFT_66483
   00531 Glycosaminoglycan degradation
    SCHCODRAFT_66483
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    SCHCODRAFT_66483
   00604 Glycosphingolipid biosynthesis - ganglio series
    SCHCODRAFT_66483
   00511 Other glycan degradation
    SCHCODRAFT_66483
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCHCODRAFT_66483
Chaperones and folding catalysts [BR:scm03110]
 Intramolecular chaperones
  Others
   SCHCODRAFT_66483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 GHL6
Motif
Other DBs
NCBI-GeneID: 9586285
NCBI-ProteinID: XP_003033723
JGI: Schco1_66483
UniProt: D8PZ82
Position
Unknown
AA seq 357 aa AA seqDB search
MSFVKMSMFHWHVVDSQSFPLVVDEFPELAETGAYAADKVYTPDDVQEIVQYAAQLGIDV
LVEIDMPGHTDIVSLSHPDWVACSQASPWSTYAAEPPSGQLRFTTPDVVDFASSLVKAVA
SKLSSSYFSTGGDEINTACFEQDEQFQKELNETGKTFDTALDAFIQDVHGTLHDINKTPV
VWEEMVLDQNVTLSNDTIVIVWISSENAAKIAEKNFKIVHGPSDYFYLDCGSGGWIGNNP
TGNSWCDPFKGWQHAYTFDPLANLTSEQATLVMGGQQLLWTEQNGPESLDSTVWPRAATS
AETFWTATQPDGSALDVNTALPRLHEVRYRLLEKGIGAKALQPEWCALRPFLCNIEA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgtgaagatgagcatgtttcactggcatgttgtggacagccagagcttcccg
ctggtggtggacgagttcccggagctggcagagacgggcgcgtatgcggcggacaaggtg
tatacgccggacgatgtgcaggagatcgtgcagtatgcagctcagctcggcattgatgtt
ctggtcgaaattgacatgccaggtcacacggacatcgtgagcctctcgcaccccgactgg
gtcgcctgcagccaggcgtcgccgtggtcgacgtacgctgccgaaccgccttccgggcag
ctgcgtttcaccacgcccgacgtcgtggacttcgcttcgtcgctcgtgaaggccgtcgcc
agcaagctctcctcatcgtacttcagcacgggcggcgacgagatcaacactgcgtgcttc
gagcaggacgagcagttccagaaggagctgaacgagacggggaagaccttcgacaccgcg
ctcgacgcgttcatccaggacgtgcatgggacgctgcacgacatcaacaagacaccggtg
gtctgggaggagatggtcctggaccagaatgtgacgctgtcgaacgatacaattgtcatc
gtctggatctcgtccgagaacgcggccaagatcgcggagaagaacttcaagatcgtgcac
gggccgtcggactacttctacctcgactgcgggagcggcgggtggattggcaacaacccg
actggaaacagctggtgcgaccccttcaagggctggcagcacgcttatactttcgacccg
ctcgcaaacctgacgagcgagcaggcaacccttgtcatgggcggccaacaactcctctgg
actgagcagaacggccccgagagccttgactcgactgtttggccgcgcgccgccacgtcc
gcggagaccttctggacggcgacgcagcccgacggcagcgcgctcgacgtcaacaccgcg
ctcccgcgcctgcacgaagtgcggtaccgcctgttggagaagggcattggcgcgaaggca
ctgcaaccggaatggtgcgcgctgaggccgttcttgtgcaacatcgaggcttga

DBGET integrated database retrieval system