KEGG   Schizophyllum commune: SCHCODRAFT_66650Help
Entry
SCHCODRAFT_66650  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
scm  Schizophyllum commune
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:scm00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SCHCODRAFT_66650
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SCHCODRAFT_66650
Protein kinases [BR:scm01001]
 Serine/threonine protein kinases: Other group
  TTK family
   SCHCODRAFT_66650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 342 aa AA seqDB search
MVNRQIYARLDMIGKGGSSRVYRAMANNNEIYAIKRVTLDKTDADTLQGYKNEIGLLKRL
AGNQRIIRLIDSEVKSGPNGRQGHLFLVMEYGEIDLARLLAEQQKEPMNMAWIAYYWQQM
LQAVQIVHDEKIVHSDLKPANFVLVKGQLKLIDFGIANAIANDTTNIQRDHQIGTLNYMS
PEAIELPEGTRRLKVGRASDVWSLGCILYQMVYGRPPFQHLSTMYHKMKAIPDASYEIEY
PEYAVPSTMKSCLMRNPKQRAVIPDLLQDDWLVMTKDPEPQKQPNAIDLLADDETIISPH
YMAQLLQHGMRIGADGGMDEEALGREAQRLVMELRALYATSH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaccgccagatctatgctcggctcgacatgatcggcaagggcggctcgtcgcgc
gtgtaccgcgcgatggcgaacaacaacgagatctacgcgatcaagcgggtgacgctggac
aagacggacgcagacacgctgcaggggtataagaacgaaattgggctgctcaagcggctc
gcggggaaccagcgcatcattcgcttgatcgacagcgaagtgaaaagtgggccgaatggg
aggcaggggcatttattcctggtgatggagtatggggagattgacctggcgaggctgttg
gcggagcagcagaaggagcccatgaatatggcgtggattgcgtattattggcagcagatg
cttcaagcggtccaaatagtgcacgatgaaaagattgtgcactccgacctgaagccggcg
aacttcgtcctggtgaagggccagctgaagttgatcgacttcggtatcgcgaatgcgatc
gccaacgacaccaccaacatccagcgcgaccaccagatcggcacgctcaactacatgtcc
cccgaggccatcgagctccccgagggcacgcggcgcctcaaggtcggccgcgcgtcagac
gtgtggtcgctggggtgcatcctgtaccagatggtgtacggccggccgccgttccagcac
ctctcgacgatgtaccacaagatgaaggcgatcccggacgcgtcgtacgagatcgagtac
ccggagtacgcggtgccgtcgacgatgaagagctgtctgatgcgcaacccgaagcagagg
gcggtcatcccggacctgctgcaggatgactggctggtcatgacgaaagatcctgaaccg
caaaagcagcccaatgccattgacttgctggctgacgacgagactatcatcagtccgcac
tatatggctcagctcctgcagcacggtatgaggatcggtgcagacggcgggatggacgag
gaagcgctggggcgtgaagcacagcgtctcgtaatggagttgagggcgctgtacgccact
tctcattga

DBGET integrated database retrieval system