KEGG   Schizophyllum commune: SCHCODRAFT_66738Help
Entry
SCHCODRAFT_66738  CDS       T01331                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
scm  Schizophyllum commune
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:scm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:scm00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 538 aa AA seqDB search
MSNERAAFAKEVAEVEQWWKSPRFERVKRPYTAADVVSKRGTLPIQYPSNVQGKKLWSIL
GEHAKRGTPSHTYGALDPVQVTQMAKYLETVYVSGWQSSSTASSTNEPGPDLADYPYNTV
PNKVEHLFQAQLFHDRKQREARSHLSDSELTSTPSIDYLRPIVADADTGHGGLTAVMKLT
KLFVEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRLQYDILGVENLAIAR
TDSEAATLITSNIDARDHAFILGSTNPSIGALNDVMLAAEREGKNGEELQATEDNWLAQA
NLQLFSKTLADALTAEGASAANVDKFLARVAHASYPEAVAVAQKEFGLKTVPFWDWDAPR
TREGFYRYQGGTQCAINRAVAYAPYADLLWMETKKPILAQAKEFAAGVHAVHPGHWLAYN
LSPSFNWDAAGLGEDDMQSYVWELGKLGFVWQFITLGGLHSNAYISDLFAREYAKTGMKA
YVELVQRKEREIGTDVLTHQKWSGADYADNLLKTVTGGISSTAAMGKGVTESQFGAKL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgagcgcgccgcattcgcgaaggaggtcgccgaggtcgagcagtggtggaag
agcccccgcttcgagcgcgtcaagcgcccctacaccgccgcggatgtcgtctcgaagcgc
ggcacgctgccgatccagtacccctcgaatgtgcagggcaagaagctttggagcatcctc
ggcgagcatgcaaagcgcgggacaccatcgcatacctatggcgcgctcgatcctgtccag
gtcacgcagatggccaagtacctcgagacggtctacgtctctggctggcaatcatcaagc
acggcgtccagcaccaatgagccgggccccgatcttgctgactacccttacaacaccgtg
cccaacaaggttgagcacctcttccaggcgcagctcttccacgatcgcaagcagcgggaa
gcgcgcagccacctaagcgactctgagctcaccagcaccccttccatcgactacctccgc
cccatcgtcgccgatgcggacaccggccacggaggcctcaccgccgtcatgaagctgaca
aaacttttcgttgagaagggcgcagcgggcatccacattgaggaccaagcccccgggacc
aagaagtgcggacacatggctggcaaggtcctcgtccccatctccgagcacatcaaccgc
ctcgtcgcgattcgcttgcagtacgacatcctcggcgtcgagaacctcgcgatcgcgcgt
acggactcggaggctgccactctcatcacgtccaacatcgacgcccgcgaccacgccttc
atcctcggcagcaccaacccctcgatcggcgcgctcaacgacgtcatgctcgccgccgag
cgcgagggcaagaacggcgaggagctgcaggcgacggaggacaactggctcgcgcaggcg
aacctccagctgttctccaagacgctcgcggatgccttgaccgccgagggcgcgtccgcc
gcgaacgtcgacaagttcctcgcgcgcgtcgcgcacgcgtcctaccccgaggccgtcgcg
gtcgcgcagaaggagttcggcttgaagaccgtgccgttctgggattgggacgcgccgcgg
acgcgcgagggcttctaccgctaccagggcggcacgcagtgcgcgatcaaccgcgccgtc
gcgtacgcgccgtacgcggacctgctgtggatggagacgaagaagccgatcctggcgcag
gcgaaggagttcgccgcgggcgtgcacgcggtgcacccgggtcactggctcgcgtacaac
ctcagcccgtcgttcaactgggacgcggcggggctcggcgaggacgacatgcagtcgtac
gtgtgggagctgggcaagctgggctttgtgtggcagttcatcacgctcggtggcctgcat
tcgaatgcgtacatctcggacctcttcgcgcgcgagtacgcgaagacggggatgaaggcg
tacgtcgagcttgtgcagcggaaggagcgcgagattggcaccgatgtcctcacgcaccag
aagtggtccggcgccgactacgccgacaacctgctcaagaccgtcaccggcggcatctcg
tcgaccgcggctatgggcaagggcgtcacggaatcgcagttcggcgcgaagttgtag

DBGET integrated database retrieval system