KEGG   Schizophyllum commune: SCHCODRAFT_67167Help
Entry
SCHCODRAFT_67167  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
scm  Schizophyllum commune
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCHCODRAFT_67167
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SCHCODRAFT_67167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 228 aa AA seqDB search
MPGPDFWRPLVLSGPSGVGKSTLLSRLFAEFPDAFGFSVSHTTRSPRPGEIDGTHYHFVT
RDAFLAMRERGAFVESAEFSGNLYGTSHAAIRAVQALGRRCILDIEAQGVRQLKQSPVFE
GAKESPDSLPKPVYVFIAPPTLADLRARLAGRGTDTQEAVQKRLATALKEIEYASSQPAP
HDLVLVNDDLDRAYALFKQIALGEQVAADAMPAYNIESAELKPVGVAS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcccggccctgatttttggcgtccgcttgttctctccggcccctccggcgtgggcaag
tctaccctccttagccgcctctttgcagagtttcccgacgcattcggcttctccgtctcg
catacaacccgcagcccgcgcccaggcgagatcgatggcacccactaccacttcgtcacc
cgcgatgccttcctcgccatgcgcgagcgcggtgccttcgtagagtccgccgagttctcc
ggcaatctctatggcaccagccacgccgccatccgcgccgtccaggcacttggccgcaga
tgcatcctcgacatcgaagcccagggcgtccgccagctcaagcagtcccccgtcttcgag
ggcgcgaaggaatcccccgactcgctcccgaagcccgtctacgtcttcattgcccctcct
accctcgccgatcttcgcgcgcgccttgctggaagaggtaccgatacccaggaggccgta
caaaaaaggctcgccaccgccctgaaggagattgagtacgcaagctcacaacccgcaccc
cacgatctcgtcctcgtcaacgatgatttggatcgcgcctacgccctcttcaagcagatc
gcactgggcgagcaagtcgctgccgatgccatgcctgcctacaatattgagtcggcagag
ttaaaacctgtcggcgtggcttcgtag

DBGET integrated database retrieval system