KEGG   Schizophyllum commune: SCHCODRAFT_68271Help
Entry
SCHCODRAFT_68271  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
scm  Schizophyllum commune
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCHCODRAFT_68271
Enzymes [BR:scm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SCHCODRAFT_68271
Transfer RNA biogenesis [BR:scm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SCHCODRAFT_68271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 354 aa AA seqDB search
MSQPYEKEAEFAVCAVRRACNLTASVFNKLIKNETLVKGDKSPVTVGDFSAQALVCTMLA
NAFPDDLIVGEEDSADLRQDTAASRALKDRIVELANEALTADLALGDKEQWGIGPGKART
PDQLLDAIDRGNYDGGRTGRMWTLDPIDGTKGFLRGGQYAVCLALIVDGEVKVGAIGCPN
LHVDAAKPDGEKGCIFVAVRGRGAQQYTLAGADPQPLRLPVLPTSQISFLESVEAAHADH
GFNARVSEVLGVTLPPVRMDSQAKYCCLARGEGGAYLRMPVGTGYREKIWDHAPGSVLVE
EAGGTISDSRGKPLDFGLGRTLGENFGVVAAEKTVHPKVIEAVQTAVAEGLAKF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaccctacgagaaagaggccgaattcgcagtctgcgccgtgcgacgcgcatgc
aatctcactgcgtcggtgttcaataagttgatcaagaacgagacgctggtgaagggcgac
aagtccccagtcacagttggcgacttttccgctcaggcgctggtctgcacgatgctcgca
aacgccttccccgatgacctgatcgtgggagaggaagactcggccgacctgcgccaggac
acggccgcgtcgcgcgcgctcaaggacaggatcgttgagctggccaacgaagcactcacc
gccgacctcgccctcggcgacaaggagcagtgggggatcgggcccggcaaggcgcgcacg
cccgatcagctgctggacgcgatcgacagggggaactacgatgggggaaggacaggacgc
atgtggacgctcgatccgatcgacggcacgaagggcttcctccgcggcgggcagtacgcg
gtctgcctcgcgctcatcgtcgacggcgaggtcaaggtcggcgcgatcggctgccccaac
ctgcacgtagacgctgccaagcccgacggcgagaagggctgcatcttcgtcgccgtccgc
gggcgtggtgcgcagcagtacacgctcgccggcgcggacccgcagcccctccgcctcccc
gtcctccccacctcgcagatcagcttcctcgagtccgtcgaggccgcgcacgccgaccac
ggcttcaacgcgcgcgtctccgaggtgctcggcgtcacgctcccgcccgtgcgcatggac
agccaggccaagtactgctgcctcgcgcgcggcgagggcggcgcgtacctgcgcatgccc
gtcggcaccggctaccgcgagaagatctgggaccacgcgccgggctcggtgctcgttgag
gaggccggcggcacgatcagcgattcgagggggaagccgctcgatttcgggctcgggcgg
acgctgggggagaactttggcgtggtggctgcggagaagacggtgcacccgaaggtgatt
gaggccgtgcagactgcggtcgcggaggggttggccaagttctag

DBGET integrated database retrieval system