KEGG   Schizophyllum commune: SCHCODRAFT_68271Help
Entry
SCHCODRAFT_68271  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
scm  Schizophyllum commune
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:scm00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 354 aa AA seqDB search
MSQPYEKEAEFAVCAVRRACNLTASVFNKLIKNETLVKGDKSPVTVGDFSAQALVCTMLA
NAFPDDLIVGEEDSADLRQDTAASRALKDRIVELANEALTADLALGDKEQWGIGPGKART
PDQLLDAIDRGNYDGGRTGRMWTLDPIDGTKGFLRGGQYAVCLALIVDGEVKVGAIGCPN
LHVDAAKPDGEKGCIFVAVRGRGAQQYTLAGADPQPLRLPVLPTSQISFLESVEAAHADH
GFNARVSEVLGVTLPPVRMDSQAKYCCLARGEGGAYLRMPVGTGYREKIWDHAPGSVLVE
EAGGTISDSRGKPLDFGLGRTLGENFGVVAAEKTVHPKVIEAVQTAVAEGLAKF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaccctacgagaaagaggccgaattcgcagtctgcgccgtgcgacgcgcatgc
aatctcactgcgtcggtgttcaataagttgatcaagaacgagacgctggtgaagggcgac
aagtccccagtcacagttggcgacttttccgctcaggcgctggtctgcacgatgctcgca
aacgccttccccgatgacctgatcgtgggagaggaagactcggccgacctgcgccaggac
acggccgcgtcgcgcgcgctcaaggacaggatcgttgagctggccaacgaagcactcacc
gccgacctcgccctcggcgacaaggagcagtgggggatcgggcccggcaaggcgcgcacg
cccgatcagctgctggacgcgatcgacagggggaactacgatgggggaaggacaggacgc
atgtggacgctcgatccgatcgacggcacgaagggcttcctccgcggcgggcagtacgcg
gtctgcctcgcgctcatcgtcgacggcgaggtcaaggtcggcgcgatcggctgccccaac
ctgcacgtagacgctgccaagcccgacggcgagaagggctgcatcttcgtcgccgtccgc
gggcgtggtgcgcagcagtacacgctcgccggcgcggacccgcagcccctccgcctcccc
gtcctccccacctcgcagatcagcttcctcgagtccgtcgaggccgcgcacgccgaccac
ggcttcaacgcgcgcgtctccgaggtgctcggcgtcacgctcccgcccgtgcgcatggac
agccaggccaagtactgctgcctcgcgcgcggcgagggcggcgcgtacctgcgcatgccc
gtcggcaccggctaccgcgagaagatctgggaccacgcgccgggctcggtgctcgttgag
gaggccggcggcacgatcagcgattcgagggggaagccgctcgatttcgggctcgggcgg
acgctgggggagaactttggcgtggtggctgcggagaagacggtgcacccgaaggtgatt
gaggccgtgcagactgcggtcgcggaggggttggccaagttctag

DBGET integrated database retrieval system