KEGG   Schizophyllum commune: SCHCODRAFT_69536Help
Entry
SCHCODRAFT_69536  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SCHCODRAFT_69536
Transcription machinery [BR:scm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SCHCODRAFT_69536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 412 aa AA seqDB search
MNNGRSKPRKTPEPKVKVEDKLDETQLTRLATGVSVDAAGSGGVLPPPKAEKPYVAELEK
GIIKIVPVINDGEPRSSILFTGLKTLFQKQLPKMPREYIARLVYDYNSRALAIIKRGLKV
VGGILFRPFPQRGFAEIVFFAIAGVDQVRGYGAMLMDNFKMHIRQTYPDMQYFLTYADNY
AVGYFEKQGFSKEISLDRSVWAGYIKDYEGGTIMQCTLLPKVDYLKKQEIVRTQQEAVLK
KIREISRSHIVHQGIPEEVWAKAMARKPPNYEPKEQKDEMVLSQEEVPGLKESGWTPDMI
VVTQVPRRNPDFAYMERLLADLKGHSKAWPFLKPVNKDEVPDYYDVITEPMDFEKMEHKL
TTLQYNNVDEFVVDAQLVFDNCRRYNPSDSVYAKAANGLEKFMKDRLAAAGR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacggtcggtcgaaaccacgaaagacaccagaaccgaaggtcaaagtcgaagac
aagctggacgagacacaactcacgcggctagccactggtgtcagcgtcgacgccgccggc
tcaggtggcgtgctcccgccaccgaaagccgagaagccatacgtcgccgagctagaaaag
ggcataatcaagatcgtccctgtgataaacgacggagagccccggtcgagcatattgttc
acggggctgaagaccctcttccagaagcagctcccgaagatgccgcgcgagtacatcgcc
cgactcgtctacgactacaactcgcgcgcactcgccatcatcaagcgcggcctcaaagtc
gtcggtggcattctcttccgccccttcccccaacgcggcttcgccgagatcgtcttcttc
gccatcgccggcgtcgatcaggtccgaggctacggtgcgatgctcatggacaacttcaag
atgcacatccgccagacctatccagacatgcagtatttcctcacgtacgcggacaactac
gccgttggctactttgagaaacagggcttctcgaaggagatctctctcgaccgctctgtc
tgggctggctacatcaaggactacgaaggcgggacgattatgcagtgcacgctgctgccg
aaggtggactatctcaagaagcaggagatcgtacgcacgcagcaggaggcggtcttgaag
aagattcgggagatcagccggagtcatattgtacaccaaggcatcccggaggaagtgtgg
gcgaaggcaatggccaggaagccaccaaattatgagccgaaagaacagaaagatgagatg
gtcctcagtcaggaagaggttcccggtctcaaggagagtggctggacgcccgacatgatc
gtcgttacgcaggtccctcgacgaaatccagacttcgcctacatggagcgtttactggca
gacctgaagggacactcgaaagcgtggcccttcctcaagcctgtcaacaaagacgaagta
cctgactattatgatgtcatcacggaacccatggactttgagaagatggagcacaagctc
acgacgctgcagtacaataacgtcgacgagttcgtcgttgatgcgcaactcgtgttcgac
aattgccgtcgttataatccgtcggattccgtctacgcgaaagcggcaaacgggctggag
aagttcatgaaagaccgcttagccgctgctgggcggtga

DBGET integrated database retrieval system