KEGG   Schizophyllum commune: SCHCODRAFT_69673Help
Entry
SCHCODRAFT_69673  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scm  Schizophyllum commune
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCHCODRAFT_69673
   00052 Galactose metabolism
    SCHCODRAFT_69673
   00500 Starch and sucrose metabolism
    SCHCODRAFT_69673
   00520 Amino sugar and nucleotide sugar metabolism
    SCHCODRAFT_69673
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCHCODRAFT_69673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 503 aa AA seqDB search
MSTLATPSNARQPRTRGVSAMNFKSATTGVASSAMKNELNRLVATEKNPQLQQAFKQEMD
SFFYLFTRYLDERAKSHELDWDKIRSPSKEQVASYADLSAPADKAALNKLAVLKVNGGLG
TSMGMKGAKSALEVKNGMTFLDLTVRQIEHLNTSLHVDVPLILMTSFNTHEDTLRIIKKY
ANQQVRITTFNQSRYPRIIAETLLPQPKSVDDDKSKWYPPGHGDLYNALVHSGVLDQLLA
DGKEYLFVSNSDNLGAVVDERILQHMIDTQAEFVMEVTDKTKADVKGGTLIDYEGQMRLL
EIAQVPNEHVEDFKSVRKFKIFNTNNLWINLKALKRIMSTEGMELDIIVNPKVADDGQAV
LQLETASGAAVKHFKNAHGINVPRTRFLPVKSCSDLLLIMSDIYSLEHGQLVINEQRMFE
TTPVIKLGDHFKKIANFQKRFKKIPNIVELDHLTVTGDVYFGRNVTLRGTVIVVANEGQR
IDIPDGCVLENRLLSGNLTMTEL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcacactagcgaccccctcgaacgcgcggcagccgcgcacccgcggcgtgtccgcc
atgaacttcaagagcgcgacgaccggcgtcgcctcttcggcgatgaagaatgagctcaac
cgtcttgttgcgacggagaagaacccgcagttgcagcaagcgttcaagcaggagatggac
tcgttcttctacctcttcacgcgctaccttgacgaacgtgccaagagccacgaactggac
tgggataagattcgctccccctccaaagagcaggtcgcatcctatgcagacctttccgcc
ccggccgacaaggctgccctcaacaagctcgccgtcctcaaggtcaatggtggtctgggt
acctcgatgggcatgaagggcgcaaagagcgcactcgaggtcaagaatggcatgaccttc
ctggaccttaccgtgcgccagatcgagcacctcaacactagcctccacgtcgatgtcccc
ctcatcctcatgacctccttcaacacgcacgaggacacgctgcgcatcatcaagaaatac
gccaaccagcaggtccgcatcaccacgttcaaccagtcgcgctacccgcgcatcatcgcg
gagacgctgctgccccagccgaagtcggtggacgacgacaagtcgaagtggtacccgccc
ggtcacggtgacctctacaatgcgcttgtgcactccggcgtcctcgaccagttgttggct
gacgggaaggaatacctcttcgtctctaactcggataacttgggcgctgtcgtggatgag
cgcatcctgcagcacatgatcgacacccaggcggagttcgtcatggaggtgacggacaag
acgaaggcggacgtgaagggtggtaccctcatcgactacgagggccagatgcgcctcctc
gaaatcgctcaggtccccaacgagcacgttgaggacttcaagtctgtccgcaagttcaag
atcttcaacacgaacaacctgtggatcaacctgaaggccctcaagcgcatcatgagcacc
gagggcatggagctcgacatcatcgtcaacccgaaggtcgccgatgacggccaggccgtc
ctgcagctcgagaccgcgtctggtgcggctgtcaagcacttcaagaacgcccacggcatc
aacgtgccccggacgcgctttttgcccgtcaagagctgctcggacctgctgctcatcatg
tcggacatctactcgctcgagcatgggcagctcgtcatcaacgagcagcgcatgttcgag
acgacgccggttatcaagttgggcgatcactttaagaagatcgccaacttccagaagcgg
ttcaagaagatcccgaacatcgtcgagcttgaccacttgacggtgacgggcgatgtgtac
ttcgggcgcaatgtgaccttgcgcggcacagtaattgtggtcgccaacgagggccagcgc
atcgatattccggacggatgtgtgcttgagaaccggctactctccggcaacctgaccatg
acggaactataa

DBGET integrated database retrieval system