KEGG   Schizophyllum commune: SCHCODRAFT_70039Help
Entry
SCHCODRAFT_70039  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     SCHCODRAFT_70039
Protein kinases [BR:scm01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   SCHCODRAFT_70039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 455 aa AA seqDB search
MSATFRFTPALWDKIHHFASFPQTGVSLQQMVLFGQNPSQGTLLKAGQFLLEELPVRLAH
RVKELDELPHNLSAMPSIKKVKNWYGQSFEELINFPAPQLPPEIRKAMTVPRLTDPPLPE
SVPNPSLTEIFGSEHAGNLANASSPYGHSMSGNGNGNGNGYNKMKLRVPMERRYYANMEG
INWPPEVHEYNKRFTQTLHKIKSRHDPTVTTVAQGVLEWKRSQNARSIGLDIQAWLDRFY
MSRIGIRFLIGQHIALNSPERHKDYVGIICTSANVHDIVLEAIENARFVCEEHYAMFAAP
PVQLICPKNLEFAYVPGHLSHICFELLKNSLRAVVERYGVDREDQGGYPPIKVVVVEGKE
DITIKISDEGGGIPRSAIPLIWTYMYTTMEGTELSDDFHASDFKAPMAGFGYGLPLSRLY
ARYFGGDLRLISMEGYGTDVYIHLNRLSSSREPLP
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaccttccgctttacgcctgcgctatgggacaagatccatcacttcgcgtcg
ttcccgcagaccggtgtgtcactgcaacagatggtgcttttcgggcagaaccccagccaa
ggcaccctcctcaaggcgggccaattcctcctagaggaactgcctgtccgcctggcacac
cgcgtcaaggagctggatgaactcccccataacttgagcgccatgccctcgatcaagaag
gtcaagaactggtatgggcagtccttcgaggagctcatcaacttcccggccccgcaactc
cctcccgaaattcggaaagccatgacggtcccccgtctcacggacccgcccctcccagaa
tccgtaccaaacccttcgctcacggagattttcggctctgagcatgctggcaacttggcg
aatgcgtcttccccttacgggcattcgatgagtggcaatggcaatggaaacggcaacggc
tacaacaagatgaagctgcgtgtacccatggagcggagatattatgcaaatatggagggc
atcaactggccgccggaggtgcacgagtacaacaagcggttcacgcagacgctgcacaag
atcaagagcaggcacgaccctacggttactactgtggcgcagggtgtcttggagtggaaa
cgcagccagaatgcacggtcgattgggcttgacatacaggcctggctcgatcgcttctac
atgtcgcgtatcggcatccgtttcctcatcggtcaacatatcgccctcaactcccccgag
cggcacaaagactacgtcggcatcatctgcacctccgccaacgtgcacgacatcgtcctc
gaggcgatcgagaacgcgcgcttcgtctgcgaggagcactacgccatgttcgccgcgccg
cccgtgcagctcatctgccccaagaacctcgagttcgcctacgtgcccggccatctgtcg
cacatctgcttcgagctgctgaagaactcgctccgcgccgtcgtcgagcgctacggcgtc
gaccgcgaagaccagggcgggtacccgcccatcaaggtcgtcgtggttgaggggaaggag
gatatcacgatcaagatctcggatgaggggggcgggatcccgcgcagtgcgattccgctc
atctggacgtacatgtatacgacgatggaggggacggagctgagcgatgatttccatgcg
agcgacttcaaggcgccgatggctggcttcggctacggtctgccgctgtcgagattgtac
gcaagatactttggcggcgacctgaggttgatctccatggagggctacgggacggacgtg
tatatccatctgaaccggctgtcgagcagcagagagcccctgccttag

DBGET integrated database retrieval system