KEGG   Schizophyllum commune: SCHCODRAFT_70386Help
Entry
SCHCODRAFT_70386  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
scm  Schizophyllum commune
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:scm00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 883 aa AA seqDB search
MTLDSASPTPSSTTLKAASRASSKASATPPPQAQPKKGKKATPNPPQFIGHLPVAREDAL
RTFRQIPENWYQYAKLGKSREAMEGSTCDCEYEEGEHAALGRDNLDHACGPRSNCINRLT
QVECLEEECHCRQFCQNQRFQRKEYAPIEIVKTEKKGFGLRAEQDIQRDTFIYEYVGDVV
NSPSFKKRMRDYAKEGIQHFYFMMLQKDEFIDATKSGGIGRFANHSCSPNCYVAKWTVGD
RVRMGIFAKRNIKKYEELTFNYNVDRYGHQAQTCYCGEPNCVGYIGGKTQTDVAVIDDVY
LEALGITDADELMELKGSKKKKGKKIDDPDFMPKMKPIKREEVPKVVQALRQVQSAKVLY
KILLRLKTTEDASALREFMRLRGFSVMRMILDEFAKDMTIVAMALECMTTWPLEKRNKVE
DSKITDPVKKYAEMEDETVKNVATKLLETWDKLEIAYRIPRLARDPSQKRKSDLAEVVTL
PHEDPRPKRVRYNIPEDEEFVDFKATLRPPIQHTAPPPSPPKPRAPSPPPRKVSYLNLAD
EKKKLLERAQQLAAEQARAHEERAKADRESKERAERKQREKESRRAARKAEKAKAREERK
AREREKKKHQTPEEKEAGKEKRLLKLVGEVVVKSMSKYAKGLPRDVFKKQAKELTHIIAE
KEKKSSSFKEGKLDALSEEKVYKMKKFSRDYIAKVMRKYQEKEKGKASRRPAGDDAASAS
ATPGASTSGTPGASTSSAALDTPDMEMTVEEAMDMEPDADDKDEKDESDSESESDSEDEE
KDGEAEAGKPNAEGDATPDVSGNGRSGDGIPDDGKGGRMDVDEEPKSAMDVDGSERSAMP
DAAPPDVVMKDGTSDGLSIPSPIGGSSTTQDPRLRSRSVTASA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaccctagactccgcgtcccccaccccatcctctacgacgctcaaagcggcctcccgg
gcgtcgtcaaaggcgtctgcgaccccgccgccacaggcccagccgaagaagggcaagaag
gcgacgcccaatccgccgcagttcattggacacttgcccgtcgcgcgcgaggatgcgttg
cgcacgtttaggcagatacctgagaactggtaccagtacgcgaaactaggcaagagcagg
gaggcgatggaaggctcgacgtgcgactgtgaatacgaggaaggtgagcatgcggcgctg
ggtcgcgacaacctcgaccatgcctgcggcccacgctccaactgcattaacaggctcacg
caggtcgagtgcttggaggaggaatgccactgcagacagttctgccagaaccaacgcttc
cagcgtaaggagtatgcgcccatcgagatcgtgaagacggaaaagaagggctttgggctg
cgtgcggagcaggacatccagagggacactttcatctacgagtacgtcggagatgtggtc
aactcgccgtcgttcaagaagcgtatgcgtgactatgcgaaggagggcatccagcacttc
tacttcatgatgctgcagaaggatgagttcatcgacgcgacgaagagcggcggcatcgga
cgcttcgcgaaccattcctgctcccccaactgctacgtcgcgaagtggacggtcggcgac
cgtgtgcgcatgggcatcttcgccaaacgaaacatcaagaagtacgaggagcttaccttc
aactacaatgtcgatcgctatggtcatcaagcacaaacgtgctactgcggcgagccgaac
tgcgtgggctacatcggcgggaaaacacaaacggacgtcgcggtcatcgacgatgtctac
ctcgaggcgttgggcataacggatgcggatgagctcatggagctgaagggctcgaagaag
aagaaggggaagaagattgacgatccggacttcatgcccaagatgaagcctatcaagcgg
gaggaggtgccgaaggtcgtgcaggcgttgcggcaagtacaaagcgcgaaggtgttgtat
aagatccttctgcgactgaagacaaccgaggacgcatcagccttgcgcgaattcatgcga
cttcgtggctttagtgttatgcgcatgatactcgacgagtttgcgaaggacatgacgatc
gtggctatggccctcgagtgcatgacgacttggccgctggagaagcggaataaggtcgag
gactcgaagatcacagatccggtgaagaaatacgcggagatggaggatgagacggtgaag
aacgtcgcgacgaagctactggagacgtgggacaagctcgagatcgcgtaccgtataccc
cgattagcccgtgatcccagccaaaagcgcaagtccgacctcgctgaggtcgtcaccctc
ccccacgaagacccccgcccaaagcgtgtgcggtataacatacccgaagacgaagagttt
gtcgacttcaaggccacccttcgtcctcctatccagcataccgcacccccacctagtccg
cccaaacctcgcgccccctccccgccgccccgaaaagtctcctacctcaacctcgcggac
gagaagaagaagctcttggagcgcgctcagcagctcgcggcggagcaggcgcgggcgcac
gaggagcgcgctaaagcggacagggagtcgaaggagcgtgctgagaggaagcagagggag
aaggagtcgaggagggcggcacggaaagcagagaaggcgaaagcaagggaagagaggaag
gcgagggagagggagaagaagaagcaccagacgccggaggagaaggaggcggggaaggag
aagcggttgctgaagctggtgggcgaggtggtggtgaagtccatgagcaagtacgcgaag
ggcctgccaagggatgtgttcaagaagcaggcgaaggagctcacgcacatcattgcggag
aaggagaagaagtcgtcgagcttcaaggagggcaagctggacgcactttcggaggagaag
gtgtacaagatgaagaagttctcgcgcgactacatcgccaaggtcatgcgcaagtatcag
gagaaggagaaggggaaggcctcacgacggcctgctggggacgacgcagcctcggcatca
gcaacacccggcgcgtcaacgtctggcacgcctggtgcatcgacgtcgtcggctgcgctg
gatacgccggatatggagatgacggtggaggaggcaatggacatggaacccgatgcggat
gataaagacgagaaggacgagtcggattcagaatcggagtcggacagcgaggatgaggag
aaggatggagaagcggaagcgggaaagccgaacgcggagggtgacgcgacgccggacgtg
agcggcaacggcaggtcaggcgacggcatccccgacgatgggaagggcgggcgaatggac
gttgacgaggagccaaaatccgctatggacgtggacggcagcgaacgatcagcgatgccc
gacgccgcacccccggacgtcgtgatgaaggacgggacgagcgatgggctgtcgataccc
tcaccgataggaggctcgagcacgacgcaggatccgcggctgcgttctcggtctgtgacc
gctagtgcatga

DBGET integrated database retrieval system