KEGG   Schizophyllum commune: SCHCODRAFT_71461Help
Entry
SCHCODRAFT_71461  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scm  Schizophyllum commune
Pathway
scm00010  Glycolysis / Gluconeogenesis
scm00051  Fructose and mannose metabolism
scm00562  Inositol phosphate metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01200  Carbon metabolism
scm01230  Biosynthesis of amino acids
Module
scm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scm_M00002  Glycolysis, core module involving three-carbon compounds
scm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCHCODRAFT_71461
   00051 Fructose and mannose metabolism
    SCHCODRAFT_71461
   00562 Inositol phosphate metabolism
    SCHCODRAFT_71461
Enzymes [BR:scm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCHCODRAFT_71461
Exosome [BR:scm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCHCODRAFT_71461
  Exosomal proteins of bladder cancer cells
   SCHCODRAFT_71461
  Exosomal proteins of melanoma cells
   SCHCODRAFT_71461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 9588458
NCBI-ProteinID: XP_003026027
JGI: Schco1_71461
UniProt: D8QM05
Position
Unknown
AA seq 251 aa AA seqDB search
MARKFFVGGNFKMNPANAAALDAIVDTLNKAQLHETADVVVAPPALYLLPLQQKLRKEIH
LAAQNCYLKDSGAFTGEISPAQLADAKIPYVILGHSERRTIFGESSDFVAQKTQAALAKG
LKVIFCIGETLQEREAGDTLKVCRAQTDAAVKLLSPADWANVVIAYEPVWAIGTGKVATP
AQAQEVHAALRAYLGEAINSDVAASTRIIYGGSVTGASAGELATQPDIDGFLVGGASLKP
EFVQIANVKGA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaagttcttcgtcggcggcaacttcaagatgaaccccgcgaacgcggcggcg
ctggacgcgatcgtggacacgctgaacaaggcgcagctgcatgagacggcggatgtcgtc
gttgcgccgcctgctctgtacctcctccccctccagcagaagctgcgtaaggaaatccac
ctcgccgcgcaaaactgctacctcaaagactcgggcgccttcaccggcgagattagcccc
gcccagctcgccgacgcgaagatcccctacgtgatcctcggccactccgagcgccgtacc
atcttcggcgagtcctccgacttcgtcgcgcagaagacgcaagcggcgctggcgaagggc
ctcaaggtcatcttctgcatcggcgagacgctgcaggagcgcgaggcgggcgacacgctc
aaggtatgccgcgcgcagacggacgcggcggtcaagctgctgagccccgcggactgggcg
aacgtcgtcatcgcgtacgagcccgtgtgggcgatcggcacgggcaaggtcgcgacgccg
gcgcaggcgcaggaggtgcacgcggcgctgagggcgtacctcggcgaggcgatcaactcg
gacgttgcggcgtcgacgcgcatcatctacggcggcagtgtcaccggcgcgagcgcgggc
gagttggccacccagccggacatcgacggcttcctcgtcggcggcgcgagcttgaagccc
gagttcgtgcagattgcgaacgtgaagggcgcttag

DBGET integrated database retrieval system