KEGG   Schizophyllum commune: SCHCODRAFT_72641Help
Entry
SCHCODRAFT_72641  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
scm  Schizophyllum commune
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCHCODRAFT_72641
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SCHCODRAFT_72641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 329 aa AA seqDB search
MSATFLRATSAIRPLSQSARFGARRFASTAPETPKKASNAPLYFALAGLAGAGAYYTLYR
EDAAPVPKQEKSPLDPDNFIDFKLKKVIPYNHNTSTFVFELPDNQSSMLPVASCVVTKSD
TLLDDKGKPVIRPYTPITPSDKQGELSILIKKYDTGKMSKHIFEMKEGDKLGIKGPIMKI
PWQINQFDEVAMIAGGSGITPMHQILEYALKNKENKTRFTLIFANVTEKDILLKEQFDEW
EKKYPNTFKAVYTLDKPSEGWKGPTGYVNAELIKQHVAPATLGEKVKVLVCGPPGQVASL
AGKKAGYAQGELSGVLKELNYTPEQVFKF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaccttcctcagggcgacctctgccattcggcccctttcccaatctgcgcgc
ttcggagcccgtcggttcgcgtcgaccgcacccgagactcccaagaaggcgtcgaatgcg
cccctctacttcgccctggccggtctggctggcgccggcgcctactacacgctctaccgc
gaggacgcggcgccggtccccaagcaggagaagagcccgctcgacccggacaacttcatc
gacttcaagctgaagaaggtcatcccctacaaccacaacacctccaccttcgtcttcgag
ctcccggacaaccagtcctcgatgctccccgtcgcgtcgtgcgtggtcacaaagtcggac
acgctcctggacgacaagggcaagcccgtcatccgcccgtacaccccgatcacgccctcg
gacaagcagggcgagctgtcgatcctgatcaagaagtacgacactggcaagatgtcgaag
cacatctttgagatgaaggagggcgacaagctgggtatcaagggtcccatcatgaagatc
ccgtggcagatcaaccagttcgatgaggtcgccatgattgctggcggtagcggcatcacc
cccatgcaccagatcctcgagtacgcgctcaagaacaaggagaacaagacgcgcttcacg
ctcattttcgccaacgtcaccgagaaggatatcctcctcaaggagcagtttgacgagtgg
gagaagaagtacccgaacaccttcaaggccgtctacaccctcgacaagccgagcgagggt
tggaagggcccgactggctacgtgaacgcggagctcatcaagcaacacgtcgcgcctgcg
actcttggcgagaaggtcaaggtgcttgtgtgcggcccgcctggtcaggtcgcttcgctt
gctggcaagaaggccggctacgcgcaaggtgaactctccggtgtcctcaaggagctcaac
tacacccctgagcaggtgttcaagttctaa

DBGET integrated database retrieval system