KEGG   Schizophyllum commune: SCHCODRAFT_72648Help
Entry
SCHCODRAFT_72648  CDS       T01331                                 

Definition
mitogen-activated protein kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
scm  Schizophyllum commune
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:scm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SCHCODRAFT_72648
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SCHCODRAFT_72648
Protein kinases [BR:scm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SCHCODRAFT_72648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 374 aa AA seqDB search
MSFIKLSIFGTNFEVTTRYVDLQPVGMGAFGLVCSAKDQLSGSSVAIKKIMKPFNTPVLA
KRTYRELKLLKHIQHENIISLLDVFISPLEDLYFVTELLGTDLHRLLTSRPLEKQFIQYF
LYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRA
PEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIETI
CSENTLRFVQSLPKRERQPFSQKLRCNDPEALDLLEKMLVFDPKKRIDATESLAHPYVSL
YHDPTDEPVAEEKFDWSFNDADLPVDTWKVMMYSEILDFHTPGAEEGDLVAKGALAGPDY
AAEEEGAAPVAAAE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcatcaagctcagcatattcggcaccaattttgaggtcaccacgcgttatgtc
gacctacagccagtgggaatgggcgcctttgggctcgtctgttccgcaaaggaccagctc
tccggctcctctgtcgcgatcaagaagatcatgaagcccttcaacacccctgtcctcgcg
aagcgcacttaccgagagctcaagctcctcaagcacatccagcacgaaaacatcatcagc
ctgctcgatgtgttcatctcgccgctagaggacttgtacttcgtgaccgagctccttggc
acggacttgcaccggctgctcacctcaagaccgctcgagaagcagttcatccagtacttc
ctgtaccagattctgcgcggtctcaaatacgtacactcggcgggcgtcgttcatcgcgat
ctcaagccgagcaacattctcataaacgagaattgtgacttgaagatctgtgatttcggc
ctcgcacgaatccaagacccgcaaatgactggctacgtttcgacgcgatactaccgcgct
cctgaaatcatgttgacctggcaaaaatacgacgtcgcggttgacatctggagtaccggt
tgcatctttgcagagatgctcgagggcaagccattgttcccgggcaaggatcacgtcaac
cagttctctatcatcaccgagttgctgggtacgccgccggatgatgtcattgagactatc
tgcagcgagaacactcttcggttcgtacaatcgctcccgaagcgcgagcggcaaccgttc
agccagaagctgcggtgtaatgacccggaggcgctcgacctcctcgagaagatgcttgtg
ttcgacccgaagaagcgcatcgacgcgaccgagtcgctcgcacacccctatgtgtcgctc
taccacgacccgacggacgagccggtcgcggaggagaagttcgactggagcttcaacgac
gcagatctgccagtagatacgtggaaggtcatgatgtacagtgagattttggactttcac
accccaggcgccgaggagggcgacctcgtggccaagggcgcgctcgccggccccgactac
gcggcagaagaggagggcgcggcacccgtcgcagcggcggagtag

DBGET integrated database retrieval system