KEGG   Schizophyllum commune: SCHCODRAFT_72648Help
Entry
SCHCODRAFT_72648  CDS       T01331                                 

Definition
mitogen-activated protein kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
scm  Schizophyllum commune
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:scm04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 374 aa AA seqDB search
MSFIKLSIFGTNFEVTTRYVDLQPVGMGAFGLVCSAKDQLSGSSVAIKKIMKPFNTPVLA
KRTYRELKLLKHIQHENIISLLDVFISPLEDLYFVTELLGTDLHRLLTSRPLEKQFIQYF
LYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRA
PEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIETI
CSENTLRFVQSLPKRERQPFSQKLRCNDPEALDLLEKMLVFDPKKRIDATESLAHPYVSL
YHDPTDEPVAEEKFDWSFNDADLPVDTWKVMMYSEILDFHTPGAEEGDLVAKGALAGPDY
AAEEEGAAPVAAAE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcatcaagctcagcatattcggcaccaattttgaggtcaccacgcgttatgtc
gacctacagccagtgggaatgggcgcctttgggctcgtctgttccgcaaaggaccagctc
tccggctcctctgtcgcgatcaagaagatcatgaagcccttcaacacccctgtcctcgcg
aagcgcacttaccgagagctcaagctcctcaagcacatccagcacgaaaacatcatcagc
ctgctcgatgtgttcatctcgccgctagaggacttgtacttcgtgaccgagctccttggc
acggacttgcaccggctgctcacctcaagaccgctcgagaagcagttcatccagtacttc
ctgtaccagattctgcgcggtctcaaatacgtacactcggcgggcgtcgttcatcgcgat
ctcaagccgagcaacattctcataaacgagaattgtgacttgaagatctgtgatttcggc
ctcgcacgaatccaagacccgcaaatgactggctacgtttcgacgcgatactaccgcgct
cctgaaatcatgttgacctggcaaaaatacgacgtcgcggttgacatctggagtaccggt
tgcatctttgcagagatgctcgagggcaagccattgttcccgggcaaggatcacgtcaac
cagttctctatcatcaccgagttgctgggtacgccgccggatgatgtcattgagactatc
tgcagcgagaacactcttcggttcgtacaatcgctcccgaagcgcgagcggcaaccgttc
agccagaagctgcggtgtaatgacccggaggcgctcgacctcctcgagaagatgcttgtg
ttcgacccgaagaagcgcatcgacgcgaccgagtcgctcgcacacccctatgtgtcgctc
taccacgacccgacggacgagccggtcgcggaggagaagttcgactggagcttcaacgac
gcagatctgccagtagatacgtggaaggtcatgatgtacagtgagattttggactttcac
accccaggcgccgaggagggcgacctcgtggccaagggcgcgctcgccggccccgactac
gcggcagaagaggagggcgcggcacccgtcgcagcggcggagtag

DBGET integrated database retrieval system