KEGG   Schizophyllum commune: SCHCODRAFT_72754Help
Entry
SCHCODRAFT_72754  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
scm  Schizophyllum commune
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:scm00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1450 aa AA seqDB search
MSELSPDVSASATAAAADVSSHPLVSLISACFWVILWALSWVKSLIGIVTISVPRLVYQI
LSYSMTLTLNFWSFVLIFGTCAVALNYFIRFRYLNDYMQLKEPPLGKPDVKELHPDVNTA
DEPANFHNYLDDFLQAVRVFGFLEKPVFHELARHLQTRRLIAGDSISLDQDRSFYCVVDG
TVQVFAKSDDEHTASGSGQWDDEDINGYHLMNEVTSGGTVSSLFTILSLFTEDVKISWQD
ADESPKRTHRSRKSTDERIRVNSDVSYFNLERPALVRTPLSNPGLRRRSSTSSSASTVQP
EESPTTPEDLRRTASPPPLSERSYAPSTPVHHIQGPVQIHRGVVARATEDTTLAVIPAEA
FRRLTKKFPKATGHIVQVILTRFARVTFNAAHKYLGLTSEVLRAEKSINDLACHPLPPSF
YEGGGLQQLRHRFEVPPSGSDSDNDYFTHTGARTHSPNPMSTYSPNPMSAQESSTDSDDS
HPAFIRTASSSTARPGSRSSTISSPNLTKTSGSRMNVQAGDLLSSTANTSRLLRPINRTA
MTPRVPLRAVVEHQSPERALGEEFNLREEVMSCIAKSIGLLQPPISGNDSLEGSPKLNPF
ERSRSPMPSSFGSLSLLDLGDDASSTMTGGSASIQSGSGMSGLDNEVEILFFPAGATLTK
AGDISTGLYYVIEGFLDILLPLEKEKQRASDRPGAKNPGKGPNKKPHDDSETHKFLFTVK
PGGIAGYLASLSNTASYVDIVAKTDTYVGYLPAQALERLLEKRPIVLLTLAKRLISLLSP
LVLQIDASLDWMQVNAGQIIWRPEDASDCFYIVINGRLRAITETEKGDVSIVGEYGQGDA
VGELDVITSSPRQNTLHAIRDTELIRMPQTLFNALSMRDPRTTQQILRKIALRVRDEAEG
GKTSQSRPPMEVKSSNANLKTICILPVSRAVPIDVFARKLQTALEGIGASTVYLNQASVA
NRLGRHVFTRMGKLKAAGWLADQEQRYRTVLYVADSPVNNSWTQTCIRQADCVMVVGMGD
DASIGEYERLLLSTKTTAKKELVLLHPDRSVAPGSTREWLKNRPWIHQHIHVELPGLVIP
ITKSTAHLPKDPDPIIALKNFKDKVQSELKKYRGTVGDARPQRLPHVNDFSRLARRICGK
SIGLVLGGGGARGVSHLGLIRALEEYGIPVDHVGGTSIGAFIGGLYAREGDSLSSAGRAK
QFSGRMGNIWRMLSDVTYPIVAYTTGHEFNRAIYKSFYDLHIEDMWLPFFCNTTNITTSG
MDIHETGYAWRFIRGSMTLVGLLPPLCDNGNMHVDGGYVDNLPVSTMFSMGSSAVFACDV
GSIDDNSPRNFGDSVSGWWLFINRWNPFSDASRVPAITEIQSRLAYVSSVRTLEEAKVAP
GCLYIAMPVQEYGTLQFSKFEELQKIGYEAGMKALAKWDEEGRLPSPFIDGKQQFSSSKK
QGRAARRNSI
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctctccccagacgtatctgcctctgctacggcggcggcagcggacgtaagc
agccatcccctcgtttccctcatctccgcctgtttctgggtgatcctatgggcgctgtca
tgggtcaagtccctcatagggatagtcaccatctctgtcccccgcctcgtataccagatc
ctgtcgtactcaatgaccctcacgctgaacttttggtcgtttgtcctgatatttgggaca
tgcgcggtcgcgctgaactacttcatacgcttccgatacctcaacgactacatgcagctg
aaggaaccgccgctgggcaagcccgatgtgaaggagcttcaccctgatgtgaacacagcg
gacgaacctgcaaacttccataattatctggacgactttttgcaggccgttcgcgtattc
ggcttcctggagaaacctgtcttccacgagctcgccagacatctgcaaactcggcgtctc
atagcaggcgacagcatctcactcgatcaagatcgcagcttctattgcgtggtggacgga
acagtccaagtcttcgccaagtccgacgacgaacatactgcatctggaagcggccagtgg
gatgacgaagacatcaatggctaccatttaatgaacgaagtcaccagcggcggcacggtg
tcaagcttgttcactattctcagccttttcacggaggatgtcaaaatcagctggcaagac
gcagacgaatctcccaagcgcacacatcgcagccggaagagcaccgatgagcgtatacgc
gtgaactctgatgtatcgtacttcaatctggaaaggccggcactagtgaggacacctcta
tcgaaccctggcttgcggagacgatcctcgacttcgtcgtctgcttcgacggtgcagccg
gaagagagcccaactactcctgaggatctgaggcgcacggcgtcccctcctccactatcc
gaacgttcctacgctccttcaacacctgttcatcatatacaaggtccagtacagatacat
cgtggcgttgtcgctcgcgcaacagaggatacgacccttgctgtgatccccgcagaggcc
ttccggcgtttgactaagaagttccccaaggcaactgggcacatcgtccaagttatcctc
actcggtttgcccgtgtaaccttcaacgcggcgcacaagtaccttggcctaaccagcgaa
gttctacgagctgagaagtcgatcaatgacctcgcctgccacccactgcccccgtccttc
tacgaaggcggcggcctccaacaactccgccaccgcttcgaagtaccacccagcggttcg
gactccgacaacgactacttcacccacaccggcgcccgcactcactcgcccaaccccatg
tcaacatactccccgaacccaatgtcggcgcaggaatcctcaacggactcggacgactcg
cacccggcctttatacgcacggcgtcctccagcacagctcgccccggatcgcgctcgtcg
acaatctcgtcacccaaccttacgaagacctccgggtcccgaatgaatgtccaggcgggc
gatctgctcagcagcacggcgaatacaagccgcttgttgcgaccgattaaccggactgca
atgaccccgagggtgcctctgcgtgctgtggtggaacaccagtcaccggagcgtgcgttg
ggcgaggagttcaatctgcgcgaggaggttatgtcgtgcattgcgaagtcgattggcttg
ttacaaccgcctatcagtggcaatgattcccttgagggatcaccgaagttaaatccattc
gagcgcagcaggtccccaatgcctagctcgtttggctcattgtctttgcttgatctgggc
gacgatgcctcttccaccatgaccggggggtcagcatcaatccagtccggaagcggcatg
agcggactggacaacgaagtggagatcttgttcttccccgcaggcgcgacactcactaaa
gcaggcgatatcagcaccggtctctactacgttatcgaaggcttcctggacatcctcttg
cctctggagaaggagaagcaaagagcctctgaccggcctggagcaaagaaccctggcaaa
ggacccaacaagaagcctcacgacgactcggagacgcacaagttcttgttcactgtcaag
cctggtggaatcgccgggtacctcgcctccctcagcaacactgcgtcatacgtcgatatc
gtggcaaagactgatacttacgttgggtaccttcccgcgcaagctctcgagcgactcctt
gaaaagcgtcctatcgtgctacttaccttggctaagcgcttgatctcgttgctgtcgccc
ctagtcctccaaatcgatgcctccctcgactggatgcaagtcaacgccggccagattatc
tggcgccccgaggacgccagcgactgcttctacattgtcatcaacggtcgcctccgtgcc
atcacagaaaccgagaaaggcgacgtctccatcgtcggcgagtacggccagggcgacgct
gtcggtgaactggacgtcatcacaagctccccaaggcagaacaccctgcatgctatccgc
gacaccgagctcatccgcatgccgcagacgctgttcaatgcgctgtctatgagggatccg
aggacgacgcaacagatactgcgcaagatcgccctccgagtgcgcgatgaggccgaaggc
ggcaaaacgtcgcagtcacgacctcccatggaggtcaagtcctcgaacgccaacctcaag
accatctgcatcctacccgtctcgcgcgccgtccccatcgacgtcttcgcgcgcaagctg
cagaccgctcttgagggcatcggggcgtcgactgtctacctcaaccaggcgtcggtagcg
aaccgcctcggccgacatgtcttcacgcgcatgggcaagttgaaggcggccggatggctc
gcggaccaggaacagagatatcgcactgtcctatacgtcgccgacagccccgtcaacaac
tcgtggacgcaaacatgtatacggcaggcggattgtgtcatggtcgttggcatgggggac
gatgcgtcgatcggggagtacgagcgccttctgttgtcgacgaagacgacggcgaagaag
gagctagtgcttctacatccggatcgctccgtggcgcccgggtcgacgagagagtggctg
aagaaccgcccttggatccatcagcacattcacgtcgaactgcctggcctcgtcatcccc
atcaccaagagcaccgcgcacctccccaaggaccccgaccccatcatcgcgctgaagaac
ttcaaggacaaagtccagagcgagctcaagaaatataggggcaccgtcggcgacgcgcgg
ccacagcgtctgccgcacgtaaacgatttctcgcggctggcgcgcaggatttgtggcaag
tcgattgggctggtgttgggtgggggtggtgccagaggggtatcgcatctgggcctgatc
cgcgcgctggaagagtatgggattccggtggatcatgtcggtggcacaagtatcggcgcc
ttcattggcggcctatatgcacgcgagggcgacagcctttcctccgctggccgcgccaag
cagttcagcgggcgcatggggaacatttggaggatgctctccgacgtcacgtaccctatt
gttgcttatacgactggtcacgaattcaaccgcgcgatctacaagtccttctatgacctg
cacattgaggatatgtggctgccgttcttctgcaacacgacgaatatcacgacgtcgggg
atggatattcatgagacgggatatgcgtggaggtttattcgggggtcgatgactttggta
ggattgttgcctccgttgtgcgacaatgggaacatgcatgtggatggaggatatgtcgac
aacttgcccgtctcgacgatgttttccatgggctctagtgctgtcttcgcgtgtgatgtc
ggatcgatcgatgacaattcgccgaggaactttggcgactcggtgtctggctggtggctc
ttcatcaatcggtggaatccgttctcagacgctagtcgggtgcccgccataacggagatc
cagagtcggctggcatatgtatcgagcgtcaggacgctagaagaggccaaggtcgcacca
ggatgcttgtacatcgccatgccggtgcaggagtatggcaccttgcagttcagcaagttt
gaggagctgcagaagattgggtacgaggctggcatgaaggcactggcgaagtgggacgag
gagggccgccttccatcgccgttcatcgatggcaagcagcagttctcttcgagcaaaaag
caaggtcgggcggcgaggagaaactcaatttag

DBGET integrated database retrieval system