KEGG   Schizophyllum commune: SCHCODRAFT_72852Help
Entry
SCHCODRAFT_72852  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SCHCODRAFT_72852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 530 aa AA seqDB search
MVPLDGENQKKRVCYFFDSDIGGFHYGPGHPMKPTRIRMCHSLVMNYGLYKKMEIFRAKP
ATKREMTQFHSDEYVDFLSKITPVNMNSHVREQHKYNVGDDCPIFDGLFEYCSISAGGSM
EGAARLSRDKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRYHQRVLYIDIDVH
HGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDVGVVKGKYYALNFPLRDGITDDNYK
SVFEPVIRSVMETYDPSAVVLQCGTDSLSGDKLGCFNLSMRGHANCVKFVKSFNKPLLLL
GGGGYTMRNVSRAWAYETGLAAGVELQPEIPVNEYYEYFGPDYQLDVKSSNAEDLNTPAY
LDRVRRIVLENLRHTGGPPSVQMQDVPIGPHDEDLADSSKDADLIPPDERRHTRLLDTRT
QNDGELSDSDDEGEGGRRDHADHKFGIGVGIFSGSGGTAAQGIGPSSHTTAAQILSGSGS
GEMDVDSPAASTPAGEPSKGSEEVPKEAEKPAAPAPAGKEGGDDSMAVDS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggttcccctggacggggagaaccagaagaagcgcgtctgctacttcttcgactcggac
attggtggctttcattatggtccgggacatccgatgaagccgacgcgcatacggatgtgc
cattccctcgtcatgaattatgggctgtataagaagatggagatctttcgtgcaaaaccc
gcgacgaagcgcgagatgacccagttccactccgacgagtacgtcgacttcctgagcaag
attacgccggtgaacatgaactcgcatgtacgggagcaacacaagtacaatgtcggagac
gattgtcctatatttgacggtctctttgagtattgttcaatatctgcgggaggctcgatg
gagggtgctgctcggttgagccgggacaaatgcgacattgccgtcaactgggccggtggt
ctgcatcacgcgaagaagagcgaggcaagcgggttctgctatgtgaacgacatcgtcttg
ggtattctcgaacttctccgctaccaccaacgtgtactatacatcgacatcgacgtccac
cacggtgatggtgtcgaggaagcgttctatacgacggatcgagtcatgaccgtcagcttc
cacaagtacggcgagtacttccctgggacgggcgagttgagggacgttggcgtcgtcaaa
ggcaaatactacgcgctcaactttcccctccgagacggtatcaccgacgacaactacaag
tccgtcttcgagcctgtcatccggtcggtgatggagacctacgacccctcggctgtggta
ctgcagtgcgggacggactcattgtcaggagataagctggggtgcttcaacttgtcgatg
cgagggcacgccaactgcgtcaagttcgttaagtcgttcaacaagccgttgttgttgctt
ggcggtggtggatacacgatgcgcaatgtcagtcgcgcgtgggcgtatgagactggtttg
gcggcgggtgtggaattgcagcctgaaatccccgtgaacgagtactacgagtactttggt
cctgattatcaactcgatgtgaagtcctcaaatgccgaggatcttaacacgcccgcatat
cttgaccgcgtacgtcggattgtgttggagaacctccgacacacaggtggcccgcctagt
gtacagatgcaggacgtccccattggcccccacgacgaggacctcgccgactccagcaaa
gacgccgatctcatcccacccgacgagcgccgccacacccgcctcctcgacacgcgcacc
caaaacgacggcgagctctccgactccgacgacgaaggagagggcggccgacgcgaccac
gcggaccacaaattcggcatcggcgtgggcatcttcagcggcagtggtggcacggccgcc
caagggattggcccgagcagtcataccacggcagcgcagatcctcagcgggagtgggagt
ggggagatggatgtggactcgccagcggcgtcgacgcctgcgggggagcctagtaagggg
tcggaggaggttcccaaggaggcggagaaaccggcggcaccagcccctgcagggaaggaa
ggaggtgatgatagcatggcggtggatagttga

DBGET integrated database retrieval system