KEGG   Schizophyllum commune: SCHCODRAFT_73134Help
Entry
SCHCODRAFT_73134  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
scm  Schizophyllum commune
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCHCODRAFT_73134
Enzymes [BR:scm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SCHCODRAFT_73134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 285 aa AA seqDB search
MPVEQTNDRVVLKHPKGASVEILLYGASVISYKVGGEERLFLSAKAALDGSKAVRGGIPV
VFPCFGPPSHPDHLRLPQHGFARSSKWTFDHIVMDNDAGVSVRLRLDPTPEIKRVFDKPF
SLAYVVTLAEHQLSTDLHVTNTSTQPWEFQALFHNYIRAPADEVTISPLSALSYYDKTES
SEEARKTPKVEQRYEVDVKKTTDSVYEAAPGKYKLAWPGGGLDIRTTNLKDVVVWNPQET
GSSMSDMEDGGWKRYVCVEPGHVRGFVQLDGEKTWVGQQVLEPKL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcgaacaaacgaacgatagagtagttctgaagcaccctaagggtgctagcgtc
gagattctgctgtacggtgcatccgttatctcatacaaggtcggcggcgaggagcgtttg
ttcctttcagccaaggctgctctcgatgggtccaaagctgttcgtggtgggatacctgtc
gtcttcccctgcttcgggccaccaagtcaccccgaccacctgcgcctcccccagcatgga
ttcgcgcggtcctcgaagtggaccttcgaccacattgtcatggacaacgatgccggggtc
tccgtgagacttcgccttgacccgactccagagataaagcgggtgtttgacaagcccttc
tccctggcttatgtcgttactttggcagaacaccaactcagcaccgacttgcacgttaca
aacacgtcgacccagccttgggaattccaagcacttttccacaactatatacgcgctcct
gcagatgaagtcacgatctctcctctcagtgccttgtcatactacgacaagacagagtcc
tcggaggaggccaggaaaacgccgaaagtggagcagcgttacgaggtcgacgtgaaaaag
acaaccgactcggtgtacgaggctgctcctggaaagtacaagctggcatggcctggcggt
ggattggacatccgtacaacgaacctcaaggatgtggttgtctggaacccacaggagacg
ggcagcagcatgtccgatatggaggatggaggatggaagcgatacgtctgcgtcgagccg
ggccatgtccgtggcttcgttcagctcgacggtgagaagacttgggtgggtcagcaagtc
ctcgaaccgaagctgtag

DBGET integrated database retrieval system