KEGG   Schizophyllum commune: SCHCODRAFT_73404Help
Entry
SCHCODRAFT_73404  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
scm  Schizophyllum commune
Brite
Chromosome [BR:scm03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    SCHCODRAFT_73404
Exosome [BR:scm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCHCODRAFT_73404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 9594549
NCBI-ProteinID: XP_003038753
JGI: Schco1_73404
UniProt: D8PRF5
Position
Unknown
AA seq 146 aa AA seqDB search
MAPKPASTAGKAPASTASKAPAKAEKAAKKTASKSAPSGGADGEKKKRKKTRKETYSSYI
YKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLAAYSKKSTISSREIQTSVRLI
LPGELAKHAISEGTKSVTKFSSQGAK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaagcccgcatcgactgccggaaaggcacccgcatccaccgcgtccaaggcg
ccagccaaggcggagaaggcggcgaagaagacggcgtccaagtctgcaccgtctggggga
gctgacggggagaagaagaagcgcaagaagacgcgcaaggagacctactcttcctacatc
tacaaggtccttaagcaggtccaccccgacacgggtatctcgaacaaggcgatggccatc
ctgaactcgtttgtcaacgatatctttgagcggatcgccaccgaggcatccaagctcgcc
gcgtactcgaagaagtcgacgatctcatcacgcgaaatccagacgtctgtgcggctcatc
ctccccggtgagctcgccaagcacgccatctctgagggcaccaagtcggtgaccaagttc
tcttcgcagggtgccaagtag

DBGET integrated database retrieval system