KEGG   Schizophyllum commune: SCHCODRAFT_75223Help
Entry
SCHCODRAFT_75223  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 732 aa AA seqDB search
MNLSSQDVAILGVGGAAAVLYLFRDQIFSSKTSSVPVPTTKAAAGEGNPRDFVAKMKAGN
KRLVIFYGSQTGTAEEYAIRLAKEAKTKFGLASLVCDPEDYDFENLDQVPEDCAVIFVLA
TYGEGEPTDNAVTLLQNFEDESFEFSNGEHKLDGLKYVMFGLGNKTYEHYNLMARKMDKM
LEDMGAVRIGERGEGDDDKSMEEDYLAWKDGMWEAFAEAMGVEEGQGGDSADFVVSELET
HPEDKVYLGELSARALTKTKGIHDAKNPYPAPVLVARELFQDVKDRNCVHMELGIEGSGM
SYQHGDHVGVWPTNADVEVDRILCALGLHNKKDTVINIESLDPALAKVPFPVPTTYGTVV
RHYIDISAVAGRQILGNLAKYAPTPEAGDYMRELNSNKELFAKVVTDGCLRVAEVLQLAA
GNDIKARPTPENTTAWDIPFDMIVSSIPRLQPRYYSISSSPKLHPNAIHVTCVVLKYENI
PSEKVQHKWVYGTGSNFLLNLKAAANGEDNVPLISSDDPSAAESTDFPRYCIEGPRGAYR
EETIYKVPVHVRRSTFRLPTNPKSAVIMVGPGTGVAPFRGFVQERIALARRSIEKNGEDA
LADWGSITLYYGCRRSDEDFLYKDEWPQYEAELKGKFQMRCAFSREPPYKPDGGKIYVQD
LIWEDKDRIADAVLNGKGYVYICGDAKNMAKSVEDTLARILGEAKGGSAEVEGAAELKLL
KERSRLLLDVWS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaacctctcctcgcaagatgtggccatcctcggcgtcgggggcgccgcagctgtcctc
tatctcttccgtgaccagatcttctcctcaaaaacgtcctccgtccccgtccccaccacg
aaggcagccgcaggcgaggggaacccgagagactttgtcgcgaagatgaaggccgggaac
aagcgtcttgtcatcttctacggttcgcagaccggtacggctgaggagtacgctatccgc
ctggcgaaggaagcgaagacgaagttcggcctcgcatcactcgtgtgcgacccggaggac
tacgacttcgagaacctcgaccaggtgcccgaggattgcgccgtcatctttgtgctcgcg
acgtacggcgagggcgagcccaccgacaatgccgtcaccctcctgcagaacttcgaggat
gagtccttcgagttctccaacggggagcacaagctcgatggtctcaagtacgtcatgttt
ggcctggggaacaagacgtacgagcactacaacctcatggcgcgcaagatggacaagatg
ctcgaggacatgggcgccgtccgcatcggcgagcgcggagagggtgacgatgacaagagc
atggaggaggactaccttgcgtggaaagatgggatgtgggaggcgttcgccgaggcgatg
ggtgtcgaggagggtcagggcggcgacagtgcggacttcgtcgtatcggagcttgagact
catccagaagacaaggtctatcttggcgaactctccgcccgcgccttgacgaagacgaag
ggcatccacgatgcgaagaacccataccccgcgcccgtccttgtcgcccgtgagctgttc
caggatgtcaaggaccggaattgcgtgcacatggagctcggcattgaaggttctggtatg
tcctaccagcacggcgaccacgtcggcgtttggcctaccaacgcggatgtcgaggttgac
cgcattctttgcgccctcggcctccacaataagaaggatacggtcatcaacatcgaatcc
ctcgacccggcccttgccaaggtgcccttccccgtccctaccacctacggcactgtcgtc
cggcattacatcgacatcagcgctgtcgctggtcgccaaatactcggcaacctcgcgaag
tatgcgcctacccctgaggcaggcgactacatgcgggaactcaactccaacaaggagctt
ttcgctaaggtcgtcactgatggctgcttgcgagtagccgaggtcctccagcttgccgcc
ggtaacgacattaaggcaagaccgacacccgagaacaccactgcttgggatatacccttc
gacatgatcgtctcctccattccccgcctccagccccgctactactccatctcctccagc
ccgaagctgcaccccaacgccattcacgtcacctgcgtcgttctcaagtatgagaacatc
ccgtccgaaaaggtccagcacaagtgggtctacggcactggctccaacttcctcctcaat
ctcaaggctgccgccaacggcgaggacaacgtcccgcttatcagctccgacgaccctagc
gcggccgagtcgaccgacttcccacgatactgcatcgagggcccgcgcggcgcataccgg
gaggagaccatctacaaggtccccgttcacgtgcggcgctcgaccttccgcctgccgacg
aacccgaagagcgcggtcatcatggtcggccccggcaccggcgtcgcgcccttccgcggc
ttcgtgcaggagcgcatcgcgctcgcgcggcggtcgatcgagaagaacggcgaggacgca
ctcgcggactggggcagtatcacgctgtactacggctgccggcggtcggacgaggacttc
ctgtacaaggatgagtggccgcagtacgaggcggagctgaagggcaagttccagatgcgc
tgcgcgttctcgcgcgagccgccgtacaagccggatggggggaagatttacgtgcaggat
ctcatttgggaggacaaggaccggatcgcggacgcggtgctgaatgggaagggctacgtg
tatatttgcggcgacgcgaagaacatggcgaagtcggtggaggacacgctggcgcggatt
ctcggtgaggcgaagggtggatcggcggaggttgagggcgcggcggagttgaagctcttg
aaggagcgctcgcgcttgctcctcgatgtctggagttag

DBGET integrated database retrieval system