KEGG   Schizophyllum commune: SCHCODRAFT_75810Help
Entry
SCHCODRAFT_75810  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
scm  Schizophyllum commune
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCHCODRAFT_75810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCHCODRAFT_75810
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCHCODRAFT_75810
Enzymes [BR:scm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCHCODRAFT_75810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 699 aa AA seqDB search
MEGIKKVFEAKKEQGSPALVTFVTAGYPTRESTVPILHALEKGGADIIELGVPFSDPTAD
GPVIQYSNTVAINNQIDYATVLGYVRQARAEGIKAPLVLMGYYNPVLAYGEDRAIEEAAA
AGANGFIMCDLPPEEAINFREKCRKYAMSYIPLIAPSTSLHRIKFLASIADSFIYVVSKM
GTTGSSDAVAINAELPAIIARVRQHATVPVAVGFGVSTRAHFDTVADAGADGVVIGSRIV
QVIKGAPTSDIATPVEEFCAAITLKGHQPHPRKAQPPSTPAPVDAVDDAPPAAISDLPMR
FGEFGGQYVAEALVECLQELEAAHRAAMADPEFWKELRSHYAYMNRPSNIYLAESLTAKT
GGAKIWLKREDLNHTGSHKINNAMGQILLARRLGKKRIIAETGAGQHGVATATVCAKFGM
ECIVYMGAEDVRRQALNVFRIEMLGAKVIPVESGSRTLKDAVNEALRDWVTNLSSTHYLV
GSAIGPHPFPTVVRDFQKVIGEEIKAQMKEATGALPDAVVACVGGGSNAIGTFYDFIKDP
SVRLIGVEAGGEGLDGTHHSATLSKGKPGVLHGVRTYIMQSETGQIMETHSISAGLDYPG
VGPEHAWLKDSGRAEYVAATDEQALRGFRMLTQSEGIIPALESSHAIWEGVRLASTLPKD
KNVVICLSGRGDKDVEEVSQILPKWANILDWHVAKRTNA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggagggcatcaaaaaggttttcgaggctaagaaggagcagggctcgcccgcgctcgtc
accttcgtcaccgcaggctacccgacaagggagtctaccgttcccatcctgcacgctctc
gaaaagggcggcgcagacatcatcgagctcggtgtccccttctcagatcccactgcagat
ggccccgtcatccagtactcgaacaccgtcgcgatcaacaaccagatcgactacgcgacc
gtgctcggctacgtccgtcaagctcgcgcagagggcatcaaggcccccctcgtcctcatg
ggctactacaaccccgtcctcgcatacggcgaggaccgcgccatcgaagaggccgccgcc
gcgggcgccaacggcttcatcatgtgcgacctcccgcccgaggaggctatcaacttccgc
gaaaagtgccgcaagtacgccatgtcctacatccccctcatcgcgccctcgacctccctc
caccgcatcaagttcctcgcctccatcgcggactccttcatctacgtcgtctccaagatg
ggcaccactggctcctccgatgccgtcgccatcaacgccgagctccccgctatcatcgcg
cgcgtccgccagcacgctaccgtccccgtcgctgtcggcttcggcgtctccacgcgcgcg
cacttcgacaccgtcgccgatgcaggtgctgacggcgtcgtcatcggctcgcgcatcgtc
caggtcatcaagggcgcgcctaccagcgacatcgcgactccggtcgaggagttctgcgcc
gccatcacgctcaagggccatcagccgcacccgcgcaaggcgcagccgccctcgacacct
gcgccggtcgacgctgtcgacgatgccccgccggccgcgatcagcgacctccccatgcgc
ttcggcgagttcggcggtcagtacgtcgcggaggcgctcgtcgagtgcttgcaggagctc
gaggccgcgcaccgcgccgccatggccgaccccgagttctggaaggagctccgcagccac
tacgcctacatgaaccgcccctccaacatctacctcgccgagagcctgaccgcgaagacc
ggcggcgcgaagatctggttgaagcgcgaggacttgaaccacactggctcgcacaagatc
aacaacgcgatgggccagatcttgctcgcaaggaggttgggcaagaagcgcatcatcgcc
gagactggtgctggtcagcacggtgttgccaccgcgaccgtctgcgccaagttcggcatg
gagtgcatcgtctacatgggtgctgaggacgttaggagacaagcccttaacgtcttccgt
attgagatgctcggcgcgaaggtcatccccgtcgagtccggatcgcgcacgctcaaggac
gccgtcaacgaagccctccgcgactgggtcaccaacctctcctccacccactacctcgtc
ggctccgccatcggcccgcaccccttcccaaccgtcgtccgcgacttccaaaaggtcatc
ggcgaggagatcaaggcgcagatgaaggaggccaccggcgcgctccccgacgccgtcgtc
gcctgcgtcggcggcggctccaacgccatcggcaccttctacgacttcatcaaggacccc
tccgtccgcctcatcggcgtcgaggccggcggcgagggcctcgacggcacgcaccactcc
gcgacgctctcgaagggcaagcccggcgtcctccacggcgtgcgcacgtacatcatgcag
agcgagaccgggcagatcatggagacgcactcgatctccgccgggctcgactacccgggc
gtcggccccgagcacgcgtggctgaaggactcggggcgcgcggagtacgtcgcggcgacg
gacgagcaggcgctgcgcgggttccgcatgctgacgcagagcgagggcatcatccccgcg
ctcgagtcgtcgcacgcgatctgggagggtgtccgcctggcgagcacgctgccgaaggac
aagaacgtcgtcatctgcttgtcgggtcgtggggacaaggacgtcgaggaggtgtcgcag
attttgcccaagtgggcaaacatcctcgactggcacgtcgcgaagcgcacgaacgcgtag

DBGET integrated database retrieval system