KEGG   Schizophyllum commune: SCHCODRAFT_75810Help
Entry
SCHCODRAFT_75810  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
scm  Schizophyllum commune
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCHCODRAFT_75810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCHCODRAFT_75810
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCHCODRAFT_75810
Enzymes [BR:scm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCHCODRAFT_75810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 699 aa AA seqDB search
MEGIKKVFEAKKEQGSPALVTFVTAGYPTRESTVPILHALEKGGADIIELGVPFSDPTAD
GPVIQYSNTVAINNQIDYATVLGYVRQARAEGIKAPLVLMGYYNPVLAYGEDRAIEEAAA
AGANGFIMCDLPPEEAINFREKCRKYAMSYIPLIAPSTSLHRIKFLASIADSFIYVVSKM
GTTGSSDAVAINAELPAIIARVRQHATVPVAVGFGVSTRAHFDTVADAGADGVVIGSRIV
QVIKGAPTSDIATPVEEFCAAITLKGHQPHPRKAQPPSTPAPVDAVDDAPPAAISDLPMR
FGEFGGQYVAEALVECLQELEAAHRAAMADPEFWKELRSHYAYMNRPSNIYLAESLTAKT
GGAKIWLKREDLNHTGSHKINNAMGQILLARRLGKKRIIAETGAGQHGVATATVCAKFGM
ECIVYMGAEDVRRQALNVFRIEMLGAKVIPVESGSRTLKDAVNEALRDWVTNLSSTHYLV
GSAIGPHPFPTVVRDFQKVIGEEIKAQMKEATGALPDAVVACVGGGSNAIGTFYDFIKDP
SVRLIGVEAGGEGLDGTHHSATLSKGKPGVLHGVRTYIMQSETGQIMETHSISAGLDYPG
VGPEHAWLKDSGRAEYVAATDEQALRGFRMLTQSEGIIPALESSHAIWEGVRLASTLPKD
KNVVICLSGRGDKDVEEVSQILPKWANILDWHVAKRTNA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggagggcatcaaaaaggttttcgaggctaagaaggagcagggctcgcccgcgctcgtc
accttcgtcaccgcaggctacccgacaagggagtctaccgttcccatcctgcacgctctc
gaaaagggcggcgcagacatcatcgagctcggtgtccccttctcagatcccactgcagat
ggccccgtcatccagtactcgaacaccgtcgcgatcaacaaccagatcgactacgcgacc
gtgctcggctacgtccgtcaagctcgcgcagagggcatcaaggcccccctcgtcctcatg
ggctactacaaccccgtcctcgcatacggcgaggaccgcgccatcgaagaggccgccgcc
gcgggcgccaacggcttcatcatgtgcgacctcccgcccgaggaggctatcaacttccgc
gaaaagtgccgcaagtacgccatgtcctacatccccctcatcgcgccctcgacctccctc
caccgcatcaagttcctcgcctccatcgcggactccttcatctacgtcgtctccaagatg
ggcaccactggctcctccgatgccgtcgccatcaacgccgagctccccgctatcatcgcg
cgcgtccgccagcacgctaccgtccccgtcgctgtcggcttcggcgtctccacgcgcgcg
cacttcgacaccgtcgccgatgcaggtgctgacggcgtcgtcatcggctcgcgcatcgtc
caggtcatcaagggcgcgcctaccagcgacatcgcgactccggtcgaggagttctgcgcc
gccatcacgctcaagggccatcagccgcacccgcgcaaggcgcagccgccctcgacacct
gcgccggtcgacgctgtcgacgatgccccgccggccgcgatcagcgacctccccatgcgc
ttcggcgagttcggcggtcagtacgtcgcggaggcgctcgtcgagtgcttgcaggagctc
gaggccgcgcaccgcgccgccatggccgaccccgagttctggaaggagctccgcagccac
tacgcctacatgaaccgcccctccaacatctacctcgccgagagcctgaccgcgaagacc
ggcggcgcgaagatctggttgaagcgcgaggacttgaaccacactggctcgcacaagatc
aacaacgcgatgggccagatcttgctcgcaaggaggttgggcaagaagcgcatcatcgcc
gagactggtgctggtcagcacggtgttgccaccgcgaccgtctgcgccaagttcggcatg
gagtgcatcgtctacatgggtgctgaggacgttaggagacaagcccttaacgtcttccgt
attgagatgctcggcgcgaaggtcatccccgtcgagtccggatcgcgcacgctcaaggac
gccgtcaacgaagccctccgcgactgggtcaccaacctctcctccacccactacctcgtc
ggctccgccatcggcccgcaccccttcccaaccgtcgtccgcgacttccaaaaggtcatc
ggcgaggagatcaaggcgcagatgaaggaggccaccggcgcgctccccgacgccgtcgtc
gcctgcgtcggcggcggctccaacgccatcggcaccttctacgacttcatcaaggacccc
tccgtccgcctcatcggcgtcgaggccggcggcgagggcctcgacggcacgcaccactcc
gcgacgctctcgaagggcaagcccggcgtcctccacggcgtgcgcacgtacatcatgcag
agcgagaccgggcagatcatggagacgcactcgatctccgccgggctcgactacccgggc
gtcggccccgagcacgcgtggctgaaggactcggggcgcgcggagtacgtcgcggcgacg
gacgagcaggcgctgcgcgggttccgcatgctgacgcagagcgagggcatcatccccgcg
ctcgagtcgtcgcacgcgatctgggagggtgtccgcctggcgagcacgctgccgaaggac
aagaacgtcgtcatctgcttgtcgggtcgtggggacaaggacgtcgaggaggtgtcgcag
attttgcccaagtgggcaaacatcctcgactggcacgtcgcgaagcgcacgaacgcgtag

DBGET integrated database retrieval system