KEGG   Schizophyllum commune: SCHCODRAFT_75880Help
Entry
SCHCODRAFT_75880  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
scm  Schizophyllum commune
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:scm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SCHCODRAFT_75880
Exosome [BR:scm04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCHCODRAFT_75880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1678 aa AA seqDB search
MAAVDISKPIAFCEHLQLSSLGIQPGAISFQNLTLESDHFICVRNEQNQLVIIDLTDPNN
VLRRPISADSAIMHPHQKILALKAQRTLQIFNIETKQKVKSHVSNEDIVFWKWVSDTTIG
MVTETSVYHWTIADSTSPPQKIFDRHATLVGSQIINYRVTPDEKWMVVVGISGNASNPSA
FKIKGAMQLYNKDRGVSQPIEGHAAAFAEMKLDGHQHPTKLFTFAVRTATGAKLHIVEID
HQAPDPPFTKKAVDVYFPPEATNDFPVAMQVSKKHGIVYLVTKFGFIHLYDLETGACIYM
NRISGETIFVTAEHEVTNGIIGVNKKGQVLSVNVDEQTIVPYILTTLNNTELAFKLASRA
NLPGADDLYIQQYQQLFASGQYGEAAKVAANSPRGILRTAQVIESFKQAPAPPGGLSPIL
QYFGVLLEKGELNHYESLELARPVLQQGRKQLLEKWLKENKLTCSEELGDIVRLHDMTLA
LSVYLRANVPNKVIACFVETGQIDKIVLYAKKVGYTPDYVALLQHVMRVDPQKGAEFAAT
LVNDETGPLVDIERVVDIFMSQNMIQPATSFLLDALKDNKPEQGPLQTRLLEMNLMHAPQ
VADAILGNEMFTYFDRPRIANLCEKAGLLQRALELYEDLADIKRVIVHSTAFPADWLVNF
FAKLTTEQSMACLQEMLKVNIRQNLQVVIQIATKYSDILGPVKLIEMFESFKSFEGLYYY
LGSIVNLSQDPEVHFKYIQAATRTGQIREVERICRESNFYNPEKVKNFLKEAKLADQLPL
IIVCDRFDFVHDLVLYLYQNGLVKFIEVYVQRVNSVRTPQVIGGLLDVDCDETTIKGLLA
SVTGNFPIDELVQEVEQRNRLKLILPWLEAKVQAGSQDPAVYNAIAKIYIDSNNNPEQFL
KENNLYEPLVVGKFCEKRDPYLAYIAYAKGFCDDELIAITNENSMFKQQARYLVKRRQPE
LWAQVLVPDNIYRRQLIDQVVATAIPECTDPDDVSVTVKSFLQADLPIELIELLEKIVID
PSPFSDNRNLQNLLLLTAIRSDKGKVVGYINKLQNYDINEIARIATEHGLFEEAFTIYKK
YEQHAQAMNVLVEHIVSIDRGLDYANKVQKPEVWSRLAKAQLDGLRIKDAIDSYIKAEDP
SNYAEVIEIAGRAGKHDDLVRFLQMARKHLREPKIDTELAYAYAKTDRLHDMEDFLGMTN
VADILEVGEKCFEDELYEAAKLLFQSISNWARLATTLIYLNENQAAVESARKAGNTQVWK
QVHAACIEKGEFRLAQICGLNIIVHAEELSALVKMYEWRGHFDEIISLLEAGLSLERAHM
GIFTELAILLSKYRPAKLMEHLKLFVARINIPKVIRAAEEGHLWPELVFLYIKYDEFDNA
SLAMIERSADAWEHNMFKETIVRVANVEIYYKALNFYLAEQPTLLNDLLTVLIPRIDHAR
VVRFFKSADHMPLIKPYLIAVQHLNIEAVNDAYNDLLIEEEDYKTLRDSVDSFDNFDSIS
LAKRLENHDLLEFRRLAAHLYKKNSRWEESISLSKHDKLYKDAIVTASVSASTEVAEELM
SYFVDIGNKECFAAMLFVCFDLIREDVVEELSWRFGLADFEMPYKIQLKRTMTEKIKQLE
KEVKERAKKEVQKEQAEAEAPIINPGSTLLLTNGFAGQAPPPMMNGGMPPMMTGFGGY
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtagacatctccaaacccatcgcattctgcgagcacctgcagctcagcagc
ctcggcattcagccgggtgcaatatcattccagaacttgacgctggagtccgaccacttc
atttgcgtgcgcaacgagcagaaccagcttgtcatcatcgaccttaccgaccccaacaat
gtcctccgccgacccatatccgccgactcagctatcatgcacccacaccaaaagatcctc
gcgttgaaggcccagcgtacgctgcagattttcaacatcgagacgaagcaaaaggtcaag
tcgcatgttagcaacgaggacattgtattctggaaatgggtctccgacacgactatcggc
atggtcaccgagacctccgtctaccactggacaatcgccgacagcacctccccgcctcag
aagatcttcgaccgccatgccactctcgtcggctcgcagatcatcaactaccgtgtcacg
cctgacgagaagtggatggtggtcgtcggcatctcgggcaacgcgtcgaacccctctgcc
ttcaagatcaagggcgccatgcagctctacaacaaagaccgtggggtcagccagcctatt
gagggtcatgctgcagcattcgcagagatgaagctcgacgggcaccagcatcccaccaag
ttgtttaccttcgccgttcgcacagccacgggcgccaagttgcatatcgtcgagattgac
caccaagcgcccgaccctccgttcacgaagaaggccgttgacgtctacttccctcctgaa
gcgactaacgacttccctgtggccatgcaggtgtcgaagaagcacggcatcgtctatctc
gtcaccaagttcggcttcattcatctctacgacctcgagaccggtgcctgcatatacatg
aaccgcatctctggggagaccatcttcgtcaccgcagagcacgaggtcactaacggcatc
atcggtgttaacaagaaggggcaggtcctctccgtcaatgtcgacgagcagacgatcgtt
ccctacatcctcactaccctcaacaacaccgagctcgcatttaaacttgccagtcgtgcg
aacttgcctggtgcggatgacttgtacattcagcagtaccagcagctgtttgcgagtggg
cagtatggcgaggcggcgaaggtcgcagccaactcgcctcgtggcattctccggacggca
caggtcatcgagtctttcaagcaggcgcccgctccccctggcggtctctcgcccattctc
cagtacttcggcgtgctgctcgagaagggcgagctcaaccactacgagtctcttgagctc
gcacgccccgttctccagcagggccgcaagcagctcctcgagaagtggttgaaggagaac
aagctcacctgcagcgaggagcttggtgacatcgtccgcctgcacgatatgacgcttgcc
ctgagcgtttacctgcgcgcgaacgtcccgaataaggtcatcgcatgcttcgtcgagacc
ggccagatcgacaagatcgtgctatacgcgaagaaggtcggctacacgccagactacgtt
gcgcttctgcagcatgtcatgcgcgttgacccgcagaagggcgcggaattcgccgcgacg
ctggtgaacgatgagaccgggccgctggtcgatattgagcgggtcgtcgacatcttcatg
tcgcagaacatgatccagccggcgacgtcgttcttgctggacgcgctcaaggacaacaag
ccggagcagggcccgctgcagacgcgcctgttggagatgaacttgatgcacgcgccgcag
gtggcggatgcgatcctcgggaacgagatgttcacctacttcgaccgcccgcggattgcg
aacttgtgcgagaaggcgggcctattgcagcgggctttggagttgtacgaggatctggcg
gatatcaagcgtgtcattgtgcactcgaccgctttccctgctgattggctcgtcaacttc
ttcgccaagcttaccaccgagcaatcgatggcctgtttgcaggagatgctcaaggtcaac
atccgccagaacctgcaggtcgtcatccagattgcgacgaagtactcggacatccttggt
ccagtcaagctcatcgagatgtttgagagcttcaagagcttcgagggtctgtactactac
ctcggctccatcgtcaacctcagccaggacccggaggtacacttcaagtacatccaggct
gctacccgcaccggtcagatccgcgaggtcgagcgtatctgccgagagagcaacttctac
aacccggagaaggtcaagaacttcctcaaggaggccaagctcgcggaccagctcccgctc
atcatcgtctgcgaccgcttcgacttcgtacacgacctcgttctgtacctctaccagaac
ggacttgtcaagttcatcgaggtgtacgtgcagcgcgtcaactcggtgcgcacgccgcaa
gtcatcggtggtctcctcgacgtcgactgcgatgagacgacgatcaagggcctgttggcg
tcggtgacgggcaacttcccgatcgacgagttggtacaggaggtggagcagaggaaccgg
ttgaagttgattctgccgtggttggaggcaaaggtgcaggctgggagccaggacccggcg
gtatacaacgccattgcgaagatctacatcgacagcaacaacaacccggagcagttcctc
aaagagaacaacttgtacgagcccttggttgtcggcaagttctgcgagaagcgcgacccg
tacttggcgtacattgcgtatgctaagggcttctgcgacgatgagctcatcgcgatcacg
aacgagaactcgatgttcaagcagcaggcgcgctacctcgtgaagcgtcgccagcctgag
ctttgggcgcaggtcctcgttccggataacatctaccgccgccagctcatcgaccaggtc
gttgccacggccatccccgagtgcacggacccggacgatgtctcggtcactgtcaagtcc
ttcttgcaggccgaccttccgatcgagctcatcgagctgctcgagaagatcgttatcgac
ccctcgccgttcagtgacaaccgcaacctgcagaacctgctcctgctcaccgccattcgc
tctgacaagggcaaggtcgttggctacatcaacaagctccagaattacgacatcaacgag
attgcgcggatcgcgacggagcacggtttgttcgaggaggcgttcacgatctacaagaag
tacgagcagcacgcgcaggcgatgaatgtgcttgttgagcacattgtgtcgattgaccgt
gggctggactacgcgaacaaggtgcagaagccggaggtgtggagtcgcttggcgaaggcg
cagcttgacggcttgcgcatcaaggacgccatcgactcgtacatcaaggccgaggacccg
agcaattatgcggaggtcatcgagatcgccggtcgcgccgggaagcacgacgacctcgtc
cgcttcctccagatggcgcgcaagcacctgcgcgagcccaagatcgacaccgagcttgcg
tatgcctacgcgaagacggaccgcctgcacgacatggaagacttcttgggcatgacgaac
gtcgcggatatcctcgaggtcggcgagaagtgtttcgaggacgagctctacgaggccgcg
aagctcttattccaaagcatctcgaactgggcacggttggcgacgacacttatctacctc
aatgagaaccaggctgctgtcgagagcgcgcggaaggctggcaacactcaggtctggaag
caggtgcacgccgcttgtatcgagaagggcgagttccgtctggcacagatttgcggtctc
aacatcatcgtgcacgcggaggagctcagcgcgctcgtcaagatgtacgagtggagaggg
cacttcgatgagatcatcagcttgcttgaggctggtctcagtcttgagcgtgcacatatg
ggtatcttcacggagttggcgatcctactcagcaagtaccggccggcgaagctcatggag
cacctgaagctcttcgtggcccgtatcaacatcccgaaagtcatccgtgccgccgaagag
ggtcacttgtggcctgagttggtgttcttgtacatcaagtacgatgagtttgacaacgca
tccttggctatgattgagcgctctgcggatgcctgggagcacaacatgttcaaggagacc
atcgttcgcgtggcaaacgtcgagatctactacaaggccctcaacttctacctcgccgag
cagccgacgttgctgaacgacttgctcaccgtcttgattcctcgtattgaccacgcccgc
gttgtccgcttcttcaagtcggcagaccacatgccgttgatcaagccatacctcatcgcc
gtgcagcatctgaacatcgaggccgtcaacgacgcgtacaacgacttgttgatcgaggag
gaggactacaagaccctccgcgattcagtggacagcttcgacaacttcgactccatcagc
ctcgccaagcggttagaaaaccacgacctgctcgagtttaggagattggccgcccacttg
tacaagaaaaactcgcgctgggaagagtccatctcgctctcaaagcacgacaagttgtac
aaggatgcgatcgtcactgcatctgtgtccgcatcgacggaggtcgctgaggagctcatg
tcgtacttcgtggacatcgggaacaaggagtgcttcgcggcgatgctgtttgtgtgcttc
gacctcattcgggaggatgtcgtggaggagctctcgtggagattcggccttgcggacttc
gagatgccgtacaagatccagttgaagcgcacgatgacggagaagatcaagcagctcgag
aaggaggtgaaggagcgggcgaagaaggaggtgcaaaaggagcaggccgaggccgaggcg
cctatcatcaacccgggtagcacgctgctcctgacgaacggcttcgcagggcaggcgccg
ccaccgatgatgaacggcggtatgccaccgatgatgactggcttcggcgggtactaa

DBGET integrated database retrieval system