KEGG   Schizophyllum commune: SCHCODRAFT_76495Help
Entry
SCHCODRAFT_76495  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K11366  ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
scm  Schizophyllum commune
Brite
Enzymes [BR:scm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SCHCODRAFT_76495
Peptidases [BR:scm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SCHCODRAFT_76495
Transcription machinery [BR:scm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SCHCODRAFT_76495
Ubiquitin system [BR:scm04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    SCHCODRAFT_76495
Chromosome and associated proteins [BR:scm03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     SCHCODRAFT_76495
    SLIK complex
     SCHCODRAFT_76495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-UBP DUF1720
Motif
Other DBs
NCBI-GeneID: 9589436
NCBI-ProteinID: XP_003032091
JGI: Schco1_76495
UniProt: D8Q489
Position
Unknown
AA seq 621 aa AA seqDB search
MHEETSTCHHIERLLASNDASAVDRFRDVVGWSVNYERAMSNPAKRRKLSNRPICDTCRV
PLARPITCLQCSYSGCWSHGHIRAHLKGSGHQFGVDPSTGSLYCLACNDFVYNSRAEALY
ADSYANAVASYLHYSDHGPAIPWIPTERDYNAINAASAVVCEGRRGLLNLGQTCFMNVVL
QSFVHNPLLRNYFLGDMHDRRICTIADCTSCEMDSLFSEIYSDESSPYGPIGFLVTTWRG
SAELAGYAQQDAHEFFISTLNQIHASSPDASPSNKCPCIVHRTFAGQLQSEVRCGRCGNV
TLTVDPMFDVSLELRGVGENTLFDCLRRFTHPEKLWTKEYSCERCGKNGQEASKRMSIRR
LPPVLSFQFKRFEQNMADKGTVRKIEASVRFPATLDMSPYTTRAMRQHAGEGLPDPPGTY
VYDLFAVINHEGQMNNGHYTNFARYGREWYRFDDDKVTNTSLATVLASAAYMCFYVKRRL
DYKDAGMAMDADVPMNFGSSQSMGFDTQPAGYDPSQPMAFDPSQPMEFDSSQPMPWEIDA
PAMDSLDPQQTGYMDPPQTGYLDPQQTGYLDSQPMDFDPSAVDPLFDDIDADGQGEDDVE
EEEEYEAARMREVEDELLDTL
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaagagacgtccacttgccaccacatagagaggctgctcgcctcaaacgacgcg
tccgccgtagacaggtttcgcgacgtggtcggatggagtgtgaattatgaacgcgcgatg
agcaatcctgcaaagaggagaaagttgtcgaataggccgatatgcgatacctgccgcgta
ccccttgcgcggcctatcacttgcttgcagtgctcttactctggatgttggtcccacggc
catatcagagcacatctcaaaggctctggtcaccagtttggcgtcgacccttccacgggc
agcctatactgcctagcgtgcaatgactttgtgtataactcaagggcagaagccctatac
gcggatagctacgcaaacgctgtcgcgtcgtacttgcactatagcgaccacggaccagca
atcccttggatacctaccgaaagggattacaatgccattaatgccgcgtccgcggtggtt
tgcgaaggtcgccgcggactgctgaacctcggccaaacctgcttcatgaacgtcgttttg
cagagcttcgtccataacccacttctacgaaactatttcctcggagacatgcacgacaga
cgaatatgcaccatcgcagactgcacaagctgcgagatggacagtctgttttccgagatc
tactctgacgaatcctctccctacggccccatcggcttcctcgtcaccacctggcgcggc
tccgccgagctcgccggctacgcccaacaagacgcgcacgagtttttcattagcacgctc
aaccagatccacgcctcctccccagacgcctcgcccagcaacaagtgcccgtgcatcgtg
caccgcacgttcgcgggccagctgcagagcgaggtgcggtgtggaaggtgcgggaatgtg
acgctgacggtggacccgatgttcgatgttagcttggagctgaggggggtgggggagaat
acgttgtttgattgtttgaggaggttcacgcatccggagaagttgtggacgaaggagtat
agctgcgagcgatgtggcaagaatggccaggaggcaagcaaacgcatgagcatccgccgc
ctgccgcccgtgctgagtttccagttcaagcgcttcgagcaaaacatggctgacaaaggc
accgttcgcaagatcgaggcttccgtgcgcttcccagccaccctcgacatgtcgccttac
acgacccgcgcgatgcggcagcatgcgggcgaaggactcccggacccaccgggcacctac
gtctacgacctcttcgccgtcatcaaccacgaagggcagatgaacaacgggcattatacg
aactttgcgcggtacggacgggagtggtaccgatttgacgatgacaaggtcaccaacacc
agcctcgccaccgttctcgcctctgcggcctacatgtgtttctacgtcaagcgtaggctc
gactacaaggacgcgggcatggcgatggacgctgacgtacccatgaacttcggctcctcg
cagtccatgggcttcgacacgcagccagcgggatacgacccctcgcagcccatggccttc
gatccctcgcaacccatggaattcgactcctcgcaacctatgccatgggagatcgacgcg
ccggccatggacagtcttgatcctcagcagacgggatatatggaccccccgcaaacggga
tatctggaccctcagcaaacgggatatctggactcgcagcccatggacttcgacccctcc
gccgtggacccgctgttcgacgacatagatgcagacgggcagggtgaggatgacgtggaa
gaggaggaggagtatgaggcggcgcggatgagggaggtggaggatgagttgttggatacg
ctgtag

DBGET integrated database retrieval system