KEGG   Schizophyllum commune: SCHCODRAFT_76670Help
Entry
SCHCODRAFT_76670  CDS       T01331                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scm  Schizophyllum commune
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:scm00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
MALSDEVKREIGQHFILGFHGQEVSEDIRTLIRNYHLGHIILMKRNIKDAAQTKRLINEL
QQIAKDAGHAKPLLIGTDQENGLVSAFSLPNGNAGTQFPGAMALAATGSPKLAYKTSQAI
AQELKYVGIQWAFGPVADVNSDPRNPVIGVRSFGDDPATVSKYVRAMTDAYEAAGVAASA
KHFPGHGDTNVDSHLGLPRIEKTLDDLRSLELVPFQAAIADKGTASIMTGHMALPKIIGD
DSPSSLSRKITTDLLREEMGYQGVVVTDCLEMDAADKHDGRGVEVGSVRALQAGADVVMI
CHTFSWQKGAIEAMHKAVEDGSLSLDALRESGKRVAAMKERFVGSWDDLRAHEAFVDSEW
ATMKEAHKALSAEAYARIVAVIKDNNVLPL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcactctcagacgaagtcaagcgcgaaattggacagcattttattctgggcttccat
ggccaggaagtatcggaggacatcaggacgctcataaggaactatcaccttgggcatatc
atcttgatgaagcgcaatatcaaagacgctgcgcagacaaagcggctaatcaatgaactt
caacaaatagcgaaggacgctggccatgccaaaccactgctcattggtacagaccaagag
aatggcctggtttccgccttcagcttgcctaacggcaatgctggcacacaattccctgga
gctatggcgctcgctgccactggctctcccaagctagcgtacaagacatcccaggccatt
gcgcaagagttgaagtacgtgggcattcagtgggcgtttgggcccgtcgcagacgtaaac
tccgaccctcgcaatccagttatcggggtgcgctcctttggcgatgacccggcgacggta
agcaagtacgtgcgcgccatgacagacgcctacgaagccgccggcgtcgcagccagcgcc
aaacactttcccggacacggcgacaccaacgttgactcccacctcggcctgccccgcatc
gagaaaaccctcgacgacctgcgcagcctcgagctcgtccccttccaggccgccatcgcc
gacaagggcaccgcaagcatcatgaccggccatatggctctgccaaagatcatcggcgac
gactcgccctcctcgctctcgcgcaagatcaccacggacctcctgcgcgaggaaatgggc
taccagggtgtcgtcgtgacggattgtctcgagatggatgcggcggacaagcacgacggg
cggggcgtcgaggttggatcggtgcgcgcgctgcaggcgggtgcggacgtggtgatgatc
tgccacaccttctcgtggcagaagggcgcgatcgaggcgatgcacaaggctgtcgaggat
gggagcctgtcgctggacgccctgcgggagagcgggaagcgcgtcgcggctatgaaagag
cgcttcgtcgggagttgggacgacctgcgtgctcacgaagccttcgtcgacagcgaatgg
gccacaatgaaggaagcacacaaggcgctgagcgcggaagcgtacgcgcgcatcgtcgcc
gtgatcaaggacaacaacgtcctcccgctc

DBGET integrated database retrieval system