KEGG   Schizophyllum commune: SCHCODRAFT_76670Help
Entry
SCHCODRAFT_76670  CDS       T01331                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scm  Schizophyllum commune
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCHCODRAFT_76670
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SCHCODRAFT_76670
Enzymes [BR:scm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCHCODRAFT_76670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
MALSDEVKREIGQHFILGFHGQEVSEDIRTLIRNYHLGHIILMKRNIKDAAQTKRLINEL
QQIAKDAGHAKPLLIGTDQENGLVSAFSLPNGNAGTQFPGAMALAATGSPKLAYKTSQAI
AQELKYVGIQWAFGPVADVNSDPRNPVIGVRSFGDDPATVSKYVRAMTDAYEAAGVAASA
KHFPGHGDTNVDSHLGLPRIEKTLDDLRSLELVPFQAAIADKGTASIMTGHMALPKIIGD
DSPSSLSRKITTDLLREEMGYQGVVVTDCLEMDAADKHDGRGVEVGSVRALQAGADVVMI
CHTFSWQKGAIEAMHKAVEDGSLSLDALRESGKRVAAMKERFVGSWDDLRAHEAFVDSEW
ATMKEAHKALSAEAYARIVAVIKDNNVLPL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcactctcagacgaagtcaagcgcgaaattggacagcattttattctgggcttccat
ggccaggaagtatcggaggacatcaggacgctcataaggaactatcaccttgggcatatc
atcttgatgaagcgcaatatcaaagacgctgcgcagacaaagcggctaatcaatgaactt
caacaaatagcgaaggacgctggccatgccaaaccactgctcattggtacagaccaagag
aatggcctggtttccgccttcagcttgcctaacggcaatgctggcacacaattccctgga
gctatggcgctcgctgccactggctctcccaagctagcgtacaagacatcccaggccatt
gcgcaagagttgaagtacgtgggcattcagtgggcgtttgggcccgtcgcagacgtaaac
tccgaccctcgcaatccagttatcggggtgcgctcctttggcgatgacccggcgacggta
agcaagtacgtgcgcgccatgacagacgcctacgaagccgccggcgtcgcagccagcgcc
aaacactttcccggacacggcgacaccaacgttgactcccacctcggcctgccccgcatc
gagaaaaccctcgacgacctgcgcagcctcgagctcgtccccttccaggccgccatcgcc
gacaagggcaccgcaagcatcatgaccggccatatggctctgccaaagatcatcggcgac
gactcgccctcctcgctctcgcgcaagatcaccacggacctcctgcgcgaggaaatgggc
taccagggtgtcgtcgtgacggattgtctcgagatggatgcggcggacaagcacgacggg
cggggcgtcgaggttggatcggtgcgcgcgctgcaggcgggtgcggacgtggtgatgatc
tgccacaccttctcgtggcagaagggcgcgatcgaggcgatgcacaaggctgtcgaggat
gggagcctgtcgctggacgccctgcgggagagcgggaagcgcgtcgcggctatgaaagag
cgcttcgtcgggagttgggacgacctgcgtgctcacgaagccttcgtcgacagcgaatgg
gccacaatgaaggaagcacacaaggcgctgagcgcggaagcgtacgcgcgcatcgtcgcc
gtgatcaaggacaacaacgtcctcccgctc

DBGET integrated database retrieval system