KEGG   Schizophyllum commune: SCHCODRAFT_77536Help
Entry
SCHCODRAFT_77536  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
scm  Schizophyllum commune
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:scm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SCHCODRAFT_77536
Enzymes [BR:scm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     SCHCODRAFT_77536
Protein kinases [BR:scm01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   SCHCODRAFT_77536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 365 aa AA seqDB search
MRPPVKPSAPLDDIRGILHELEAIRTEEVAVPSDTGSPAAPPPPWSDDVLEELARLGEGT
GGAVTKVRDTRTGKIMARKTITTREAPMKQLLRELSIISSTQHHNIIVFHGAYMSPSTSE
VKILMEFCEGGSLESVGKKIREMNAVVGEKIAGRLAEGVLAGLNYLHSKRTIHRDIKPSN
ILLNKQGVVKLCDFGVSGELVNSMAGTFTGTSFYMAPERISGHEYTIRSDVWSMGITLLE
LVMNRFPFPADLPAIELMMYITASEPPRLEDENGIVWSDDMKDFIKQSLIVDGKERPTPR
DLLRHPWIVNVMREEVHMAKWIRKIWGWSRPTRQSGEGSRPGTGSGARASSRQRAGSRSS
QDYDA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccccgtgaagccgtccgcaccgctagacgacatacgcggcattctgcacgag
ctcgaggcgatacgcaccgaggaggtcgccgtgcccagcgacacgggctcgccagccgcg
ccgccgccgccttggtcagacgacgtgctcgaggagctcgcaagattgggcgagggaact
ggaggcgcggtgaccaaagtgcgcgatacgcgcacgggcaagatcatggcgcgcaagacc
atcaccactcgcgaggcccccatgaagcagctactgcgcgaactatccatcatttcctct
acgcagcaccacaacatcattgtcttccatggcgcctacatgtctccttcgacgtcggag
gtcaagatactgatggagttctgcgagggcgggagtctggaaagcgtcggaaagaagatc
cgcgagatgaacgcggttgtgggcgagaaaatcgctggacgactggcggaaggggttctg
gctggcttgaactacctgcactccaagcgtactattcatcgcgacatcaagccatcaaat
atcctgttgaacaagcaaggcgtagtcaagttgtgtgacttcggcgtttccggagaactt
gtgaactctatggcgggcacgttcactggcaccagcttctatatggcacccgagcggata
tcgggccacgaatacaccatcagatccgacgtctggtctatgggtatcaccctactggag
ctcgtgatgaaccgcttcccattcccggccgacttgccagccatcgaactcatgatgtac
atcactgccagcgagccgccgagactcgaggacgagaatgggatcgtctggagcgacgac
atgaaggacttcatcaagcagtcgctcatagtggacgggaaggagcgtccaacgccccgc
gatctcctgcggcacccctggattgtgaacgttatgcgggaagaggttcacatggccaag
tggataaggaaaatttggggttggtcccggcccacgaggcagtcaggagaaggttctcgc
cccggaacgggcagcggtgctcgcgcatcttcgaggcagcgcgccgggtctcgcagctcg
caagattacgatgcctaa

DBGET integrated database retrieval system