KEGG   Schizophyllum commune: SCHCODRAFT_78186Help
Entry
SCHCODRAFT_78186  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scm  Schizophyllum commune
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:scm00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scm00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 504 aa AA seqDB search
MASLMPNRAESFNTRTRGTSHIDFKTATTGVAAKAMRNELSHLVSTISDPQEKKNFDMEM
QSFFFLFTRYLAERAQSQDLDWDRIKSPSDDKVVPYAQLSEPKDKSVLNKLAVLKVNGGL
GTSMGMTGAKSALEVKNDMTFLDLTVRQIEHLNTSNRVDVPLLLMTSFNTHDDTLRIIKK
YANQQLRITTFNQSRYPRIFKETLLPCPKRADDDKKHWYPPGHGDVFNALYQSGVLDQLI
SEGKEYIFISNSDNLGAVVDEKILQHMIDSEAEFIMEVTDKTKADVKGGTLIDYDGNIRL
LEIAQVPSEHVEDFKSVRKFKIFNTNNLWVNLKAIKRVMENEGMELEIIINPKVNDDGQP
VIQLETAAGAAIKHFKNGHGINVPRSRFLPVKSCSDLLLIKSDIYSLEHGQLVINEQRMF
ETTPVIKLGDHFKKIQQFQKRFKKIPKILELDHLTVTGDVYFGRNVTLRGTVIIVANEGQ
SIYIPDGCILENRLLSGNLNMIEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccttatgcccaaccgcgcagagtcgttcaacacccgcactcggggaacgagc
catatcgatttcaagaccgcgaccaccggtgtcgcggccaaggccatgcgcaatgagctg
agccatctcgtctccacgatctccgacccgcaggagaagaagaactttgacatggagatg
caatccttcttcttcctcttcacccgctacctcgccgagcgcgcccagagccaggatctc
gattgggaccgtatcaagtcgccctccgatgacaaggtcgtcccctatgcgcagctctcc
gagcccaaggacaagagcgtcctcaacaagctcgccgtcctaaaggtcaacggtggtctc
ggcacgtccatgggcatgaccggcgcgaagagcgcgctcgaggtcaagaacgacatgacc
ttcctcgacctcaccgtgcgacagatcgagcacctcaacacgagcaaccgcgtcgatgtt
ccgctcctcctcatgacgtccttcaacacgcatgacgataccctgcgcatcatcaagaag
tacgcgaatcagcagttgcgcatcaccactttcaaccagagccgctacccccgtatcttc
aaggagaccctcctcccgtgtcccaagcgcgcggacgatgacaagaagcactggtacccg
cccggtcacggtgacgttttcaacgcgctctaccagtctggtgtcctcgatcagttgatc
tcggagggcaaggagtacatcttcatctcgaactcggacaacttgggcgctgtcgtcgac
gagaagattctccagcacatgatcgactctgaggctgagttcatcatggaggtcaccgac
aagacgaaggctgacgtcaagggtggtaccctcatcgactacgatggcaacatccgcctc
ctcgaaattgctcaggtcccatccgagcatgtcgaggacttcaagtccgtccgcaagttc
aagatcttcaacaccaataacctctgggtgaacctgaaggcgatcaagcgcgtcatggag
aacgagggcatggagctcgagatcatcatcaacccgaaggtgaacgacgacggccagccg
gtcatccaactcgagaccgccgcgggtgccgcgatcaagcacttcaagaacgggcacggt
atcaacgtgccgcggtcgcgcttcttgcccgtcaagagctgctcggacctgctgctgatc
aaatcggacatttactcgcttgagcacggccagctcgtcatcaacgagcagcgcatgttc
gagacgacgccggtgatcaagcttggggaccacttcaagaagatccaacaattccagaag
cgcttcaagaagatccccaagatcctcgagctcgaccacttgacggttactggcgacgtc
tactttggccgcaacgtcactttgcgcgggacggtcatcatcgtcgcgaacgaggggcag
agcatctacatccccgacggctgcatactggagaaccgcctcctgtcgggcaacctgaac
atgattgagctgtga

DBGET integrated database retrieval system