KEGG   Schizophyllum commune: SCHCODRAFT_79892Help
Entry
SCHCODRAFT_79892  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
scm  Schizophyllum commune
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:scm00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:scm04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 801 aa AA seqDB search
MLKDGTPMDKVTNKKRKRVIFRVDADIGHIVWEGRIHRFIPIENIKEIRTGADARLHRQH
FQLSEEYENRWLTIIYVLAGNYKTLHLIAPTHDAFTMWDRTLRQLHTIRAALMTGLDHGE
MRQAVWERQYWTRADEQRDHVLVFEEVQKLCRQLNINSASEDLQRLFKQADRQGRNYLDF
DDFRFFVKLLKARPEVERLYKKLAAGGAFDFETFAKFMREEQESTLTEVELRAIYDKHTA
QTSPTTPPSDSPGSPPCLTLDAFTNFLMSSDNAALDDGSTHDMTRPLSEYYISSSHNTYL
VGHQLVGVSTVEGYIRALLSGCRSVEVDIYDGPTPSSEPLIFHGKTLVSKVPLRSVCAAI
AKYGFVASPYPLIISAEMHCSVLGQVQVARVMIEEFGDTLVRVPLEDVPEDGWKVDHLPS
PEELRGKILLKSKNVYGILQRVRTRRSNSSAARTSAASAPAALNGAISSSPPSMHWRNSS
MSRRQSENSTTTTPAKPKMARELLALLVYTMGVKCRGLNKKETYEPSHMFSLSENRANKM
LLKTPTGMLDLAKHCRDHLVRVYPRGTRVSSSNFPAEAVVRYWCAGAQVVAINWQTFDLT
YMLNHAMFQRNGRRGYVLKPSPLRAPTRDLFANTAGRIFDVEIISAQQLPRAKDATGREI
LGIVDPYVEVSIHVPEWHLLQRAPGSGSGRDSPFESGEPAAKRVFVRTGTVRANGFNPVW
EQRLLIPFSVAGGEDMYDLIFVRFEVKQEAGTADEDDMPLAVYCSSLGALARGYRHLPLH
DAHLSQYLFSTLFVRIGVRDA
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaggacgggacgccgatggacaaggtcacgaacaagaagcgcaagcgcgtcatc
ttccgcgtcgacgcagacattgggcatatcgtctgggaggggaggatacaccgattcatc
ccgatcgagaatatcaaggagattcgtacgggcgcggatgcgcgcctgcacaggcagcac
ttccagctctcagaagagtacgagaaccggtggctcacgatcatctacgtgcttgctggc
aactacaagaccctgcatctcattgctcccacgcacgacgcgttcacaatgtgggaccgc
actctccgccagcttcacaccatccgcgccgcgctcatgaccggtctcgatcacggcgag
atgcgtcaggccgtttgggaacgtcagtactggacgcgtgccgacgagcagcgtgatcac
gtgctcgtcttcgaggaagtgcagaagctctgccgccagctgaatatcaactcggcgtcg
gaggatcttcagcgtctattcaagcaagcagatcgccaggggcgcaactaccttgacttc
gacgacttccgattctttgtcaagctgctcaaagcgcgtccggaagtcgagcggctttac
aagaaattagccgccggtggcgcgttcgacttcgagacattcgccaaattcatgcgcgaa
gagcaggagtcgacgctcaccgaggtggagctacgcgccatttacgacaagcataccgct
cagacgtctccgaccaccccgccctctgactctcccggttccccaccatgccttactctg
gacgcgttcaccaacttcctgatgtcttccgataatgcggcgctggacgatggttcaact
catgacatgacccggcctttgtctgaatactatatttcctcatcacataatacttacctc
gttggccaccagctcgtcggcgtcagcacggtcgagggctacattcgcgcgctccttagt
ggttgccgcagcgtcgaggtcgacatctacgacggcccgacaccgagctcggagcctctg
attttccatgggaagacgctcgtgagcaaggtgccgctgcgctcagtgtgcgcggcgatc
gcgaagtacggcttcgtggcgagcccgtacccgctcatcatctcggcggagatgcactgc
agcgtgctcggacaggtgcaggtcgcgcgcgtcatgatcgaggagttcggggacacgctg
gtgcgcgtaccgctcgaggacgtgcccgaggatggttggaaggtagaccacttgccgagt
ccggaggagctgcgtgggaagatcttgctcaagtcgaagaacgtgtatggtatactccag
cgtgtacgcacacgtaggtcgaactcgagtgccgcacgcacctcggctgcctccgctccc
gcagcgctcaacggcgccatctcttcgtccccaccctccatgcactggcgcaactccagc
atgtcgcgccgacagtctgagaacagcaccaccaccactcccgcaaagcccaagatggcg
cgcgagctgcttgcgctgctggtgtacacgatgggcgtcaagtgtcgcgggctgaacaag
aaggagacgtacgagccgtcgcacatgttctcgctctctgaaaaccgggcgaacaagatg
cttctgaagacgccgacggggatgctggacttggcaaagcattgccgcgatcatttggta
cgggtgtacccgcgagggacgcgtgtcagctcgagcaacttcccggcggaggcggtcgtg
cggtactggtgtgcaggcgcgcaggtcgtggctatcaactggcagacctttgacttaacg
tacatgctcaaccacgccatgttccagcggaatggacggcgaggatatgtcttgaagccc
tcaccgcttcgcgcacctaccagggatctgtttgccaacaccgccggacgcatattcgat
gtcgagatcatctctgcgcaacagctgcctcgagcgaaggacgcgaccgggcgcgagatc
ctcggcatcgtcgacccttacgtcgaggtcagcatccacgtccccgagtggcacctcctg
cagcgcgcgcctggcagcggcagcggacgcgactctcccttcgagagcggcgagcccgcg
gccaagcgtgtcttcgtgcgcacggggacagtccgcgcgaacggtttcaacccggtgtgg
gagcagcggctcctgatccccttctctgtcgcgggcggagaggatatgtacgatctgatc
ttcgtgcgcttcgaggtgaagcaggaggctgggactgccgacgaggacgatatgccgctc
gctgtgtattgctctagtttgggggcacttgcgcggggttaccgccacttgcccctccac
gacgcccatctctcgcaatatctattctctaccctcttcgtgcgcatcggcgtccgcgat
gcg

DBGET integrated database retrieval system