KEGG   Schizophyllum commune: SCHCODRAFT_79963Help
Entry
SCHCODRAFT_79963  CDS       T01331                                 

Definition
glycosyltransferase family 39 protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
scm  Schizophyllum commune
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    SCHCODRAFT_79963
Enzymes [BR:scm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     SCHCODRAFT_79963
Glycosyltransferases [BR:scm01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   SCHCODRAFT_79963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 824 aa AA seqDB search
MDVHPPLAKLLITLVAFIFGYDGHFDFKDIAKVYDDTTPYVAMRMLPGILGVATVPLAYL
TIRALDCRATTALLASVFIIFENAMVTQSRHILLDSPLIFFTALSIFFWAGFCNEDKHQP
FTETWWAWLALSGLSLGAVLSCKWVGLFTVATVGFSTIYQLWQLLGDLRVPPRLFVKHFL
ARALCLIVIPILFYMSMFQIHFAILQSSGDGDGFMSSEFQHTLSGRHMADTFADVAIGST
VTIRHVNTQGGYLHSHPHNYPGGSKQQQVTLYPHRDSNNEWAVINATAEDWDAWRDAEDV
AYLTHGTRIKLRHIQTQRNLHSHDIRPPVSDVDFQNEVSAYGMANFAGDANDDWIVEIEH
GDRRDKESYKRVRTLRTTFRLRHALQGCYLFSHKVKLPDWGWEQQEVTCNKNAVRDNSLW
FVETNVHPNLPDDAPKVNYRLPGFLSKFWELQQVMWTTNQGLTDRHTFDSRPDSWPRLRR
GINFWVKDHRQIYLIGNPMLWWLSTAAVLAYVAFRAFVILRAKRGYRDMDNSKVLKYDGL
CGFLFMGWALHYFPFYLMGRQLFLHHYLPALYFAILLLCVVFDVLTSTLRTRYRLGVAAL
LLLVAIANFNHLSPLAYGTPWTKKQCESARWLKTWDFSCNDFFDDYAKYETTIPHTPQKS
SVATVGGEPGGRAPIVVHEEKPAEEEPHTSAIGAKVEPGRNIFNEEKKDVKSAAAPERVE
VVQEEKQISSVLTNQGEGGAKHPEGAPVQEQGKEKVEEKVTVAAVAEGTTQEVPAEEAKV
EQPADAEKPVEAEEKKEAGPAGEAEVEADRVAQELYPEAADAAA
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgcatccccctctggcgaagctgctgatcacccttgttgccttcatctttgga
tatgatgggcactttgacttcaaggacattgcaaaagtctacgacgacaccaccccctac
gtcgccatgcgcatgctccctggcatcctcggcgtcgcgaccgtacccctcgcctacctc
accatccgcgcgctcgactgccgcgcgaccaccgcgctcctcgcctccgtcttcatcatc
ttcgagaacgcgatggtcactcagtctcgccacatcctcctcgactcgccgctcatcttc
ttcaccgcgctcagcatcttcttctgggctggcttctgcaacgaggacaagcaccagccg
ttcacggagacgtggtgggcctggctcgcgctgtcgggcctctcccttggtgcggtgctg
agctgcaagtgggtgggcctgtttacggtcgcgacggtcggcttcagcacgatctatcag
ttatggcagctcctaggtgacttgcgcgtgccgcccaggctgttcgtcaagcacttcctt
gcgcgcgccctgtgcctgatcgtcatccccatcctcttctacatgtccatgttccagatc
cacttcgccatcctccagtcctcgggcgacggcgacgggttcatgtcctccgagttccag
cacacgctctccgggcggcacatggcggacaccttcgccgacgtcgccatcggctccacc
gtcaccatccggcacgtcaacacgcagggcggctacctccactcgcacccgcacaactac
ccgggcgggagcaagcagcagcaggtcacgctctacccgcaccgcgactcgaacaacgag
tgggcggtgatcaacgcgacggcggaggactgggacgcgtggcgcgacgcggaggatgtc
gcgtacctcacgcacggcacgcgcatcaagctgcgccacatccagacgcagcgcaacctg
cactcgcacgacatccgcccgcccgtgagcgacgtcgacttccagaacgaggtgtcggcg
tatgggatggcgaactttgcgggggacgcgaatgatgactggattgtggagattgagcat
ggggatcggagggataaggagtcgtacaagcgcgtgcggaccctacggacgacgttcagg
ctgcggcatgcgctccaggggtgctacctgttctcgcacaaggtcaagctgccggactgg
ggctgggagcagcaggaggtgacgtgcaacaagaatgcggtgcgcgacaactcgctgtgg
ttcgtggagacgaatgtgcatcccaacttgccagacgacgcgcccaaggtcaactaccgc
ctgccgggcttcctctcgaagttctgggagctgcagcaggttatgtggacaacgaaccag
ggtttgacggaccgtcatacgtttgactcgcgccctgattcctggccgcgtctgcgccgt
ggcatcaacttctgggtcaaggaccaccgccagatctacctcatcggcaaccctatgctg
tggtggctgagcacggcggctgtcctcgcctacgtcgccttccgcgccttcgtcatcctg
cgcgccaagcgcggctaccgcgatatggacaacagcaaggtcctcaagtacgacggcctc
tgtggcttcctcttcatgggctgggcgctgcactacttccccttttacctcatgggccgc
cagttgttcctccaccactacctacctgctttgtacttcgccatccttcttctttgcgtc
gtctttgacgtcctgacgtcaacactgcgcacgcgctatcggctgggtgtggctgcgttg
ttgctgttggtcgccatcgcgaacttcaaccatctgagcccgttggcttatggcacgccg
tggacgaagaagcagtgcgagagtgcgaggtggctgaagacgtgggatttctcgtgtaac
gacttctttgacgattacgccaagtacgagacgaccatcccgcacacgccgcaaaagtcg
agcgtcgccaccgtcggcggcgagcccggcgggcgcgcgcccatcgtcgtgcacgaagag
aagcccgcggaggaagagccgcacacgtccgcaatcggcgcgaaggtcgagcccgggcgc
aacatcttcaacgaggagaagaaggacgtgaagagcgccgcggcgccggagcgcgtcgag
gtcgtgcaggaggagaagcagatcagctccgtgctgacaaatcagggcgagggcggggcg
aagcacccggagggcgcgccggtgcaggagcaggggaaggaaaaggtggaggagaaggtg
acggtggccgcggtggcggagggcacgacgcaggaggtgccggctgaggaggcgaaagtg
gagcagcctgccgatgctgagaagccggtggaggcagaggagaagaaggaggcgggccct
gcgggcgaggctgaggtcgaagctgaccgggtggcgcaggagttgtaccccgaggccgcg
gatgcggctgcatga

DBGET integrated database retrieval system