KEGG   Schizophyllum commune: SCHCODRAFT_80554Help
Entry
SCHCODRAFT_80554  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
scm  Schizophyllum commune
Brite
Protein phosphatases and associated proteins [BR:scm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SCHCODRAFT_80554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 Anthrax-tox_M
Motif
Other DBs
NCBI-GeneID: 9589491
NCBI-ProteinID: XP_003036958
JGI: Schco1_80554
UniProt: D8PLW2
Position
Unknown
AA seq 175 aa AA seqDB search
MGQTQSQFMEDMSRRSNFTPQELDRLKKRFMKLDSNRSGSIDREEFLQIPQIATNPLASR
MIAIFDEDGGGTVDFQEFVGGLSAFSSRGGRDEKLKFAFKVYDVDRDGYISNGELFLVLK
MMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFALMVSNTDIVKQMTLEDLF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaacacaatcacagttcatggaggacatgtcgcggcggtcaaacttcacgccg
caggagctggaccgcctcaagaagcggttcatgaaactggacagcaaccgctccggctca
atcgaccgcgaggaattcttgcaaataccacagatcgcgacgaacccgctcgcgtcgcgc
atgatcgcgatcttcgatgaagacggcggcgggacggttgatttccaggaattcgtcggt
ggcctcagcgcgttcagcagtaggggaggacgcgacgagaagctgaagttcgccttcaag
gtctacgacgtcgaccgggacgggtacatatcgaacggcgagctcttcttggtgctgaag
atgatggtggggaacaacttgaaggaccaacaactgcagcagatcgtcgacaagacgatt
atggaggcggacaaggacggtgacgggaagctcagcttcgaggagttcgcgctgatggtg
tcgaatacggatatcgtcaagcagatgacgttggaggacttgttctaa

DBGET integrated database retrieval system