KEGG   Schizophyllum commune: SCHCODRAFT_81014Help
Entry
SCHCODRAFT_81014  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scm  Schizophyllum commune
Pathway
scm00010  Glycolysis / Gluconeogenesis
scm00020  Citrate cycle (TCA cycle)
scm00620  Pyruvate metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01200  Carbon metabolism
Module
scm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCHCODRAFT_81014
   00020 Citrate cycle (TCA cycle)
    SCHCODRAFT_81014
   00620 Pyruvate metabolism
    SCHCODRAFT_81014
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCHCODRAFT_81014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 9594864
NCBI-ProteinID: XP_003037577
JGI: Schco1_81014
UniProt: D8PKQ0
Position
Unknown
AA seq 451 aa AA seqDB search
MSASVARVFARRLHASSYRRALAQFNMPAMSPTMTEGGIASWKKKEGETFAAGDVLLEIE
TDKATIDVEAQDDGVLAKIIVNDGAKGVKVGAPIAIVGEEGDDLSKAADMAKAAEAPEPP
KKEEKAPEPPKSEAPPPSESKSAPPKTESKADLPAGDRIFASPIAKKIALEKGIPLAKVK
GSGPEGRILREDVEKFKPEAAASAPAGVSGGAPAASPEEYTDTPLSNMRRVIGQRLLQSK
VEVPHYYLTVDINMDKVLKLREVFNKTLAEKDKGAKLSVNDFVVKAVGCALADVPEANSA
FFGDYIRTYKKADISVAVATPTGLITPIIKDVGGKGLATISAEAKSLAKKARDGKLQPQE
YQGGTFTISNLGMFDISHFTAIINPPQSCILAVGSTQPTLVPAPEEERGFKTANIMKVTL
SSDHRTVDGAIGARWLSAFKGYLENPLTFML
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctccgttgcccgcgttttcgcaagacgtctccatgcctcgtcataccgcagg
gcgctggcgcaattcaatatgcccgccatgagcccgaccatgactgagggtggtatcgcg
tcctggaaaaagaaggagggcgagaccttcgcggcgggtgacgtgctccttgagattgaa
accgacaaggcgacaatcgacgtggaggctcaggacgacggtgttctcgcgaagattatc
gtcaacgacggtgccaagggcgtcaaggtcggcgcgcctatcgccatcgtcggtgaggag
ggtgacgacctgtcgaaagctgcggacatggcgaaggctgctgaagcgccggagcccccc
aagaaggaggagaaggcacccgagccccccaagtccgaagcaccccctccctccgagtcc
aagtctgccccgccgaagaccgagtccaaggccgacctccccgcgggcgaccgcatattc
gcgtcccccatcgcgaagaagattgcgctcgagaagggcatccccctcgccaaggtgaag
ggctcgggtccggagggccgcatcctgcgtgaggacgttgagaagttcaagcctgaggct
gctgccagtgccccggctggcgtgtctggcggcgcgcccgccgcgtccccggaggagtac
acggacacgcctctgtcgaacatgcgccgcgtgatcggccagcgcctgctccagtccaag
gtcgaggtcccgcactactaccttaccgtcgacatcaacatggacaaggtgctcaagctg
cgcgaggtgttcaacaagacgcttgcggagaaggataagggcgcgaagctcagcgtgaac
gactttgtcgtcaaggctgtcggctgcgcgctcgcggacgtgccagaggcgaactcggcg
ttcttcggtgactacatccggacatacaagaaggcagacatctccgtcgccgtggccacc
ccaaccggcttgatcacccccatcatcaaggacgtcggcggcaagggcctcgcaaccatt
tccgcggaggctaagtcgctcgcgaagaaggcgcgcgacggcaagttgcagccgcaggag
taccagggcggcaccttcaccatctcgaacctcggcatgttcgacatctcgcacttcacc
gcgatcatcaacccgccgcagtcgtgcatcctcgccgtcgggtcgacgcagccgacgctc
gtgcctgcgccggaggaggagcgcgggttcaagacggcgaacatcatgaaggtgacgctg
agctcggaccacaggacggtggacggcgcgatcggcgcgcggtggttgtcggcgttcaag
ggctacctcgagaaccccttgacgttcatgctctag

DBGET integrated database retrieval system