KEGG   Schizophyllum commune: SCHCODRAFT_81171Help
Entry
SCHCODRAFT_81171  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
scm  Schizophyllum commune
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCHCODRAFT_81171
Enzymes [BR:scm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SCHCODRAFT_81171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 552 aa AA seqDB search
MVWVYALLGAHTALAAASLLDRNMVYRSPLVDIPKGDPYDTSVLLWTRAAPSSDSATQPD
QSVPICVSYTISASPDLSSPLDSGSAFTNYDVDFTVKVEATGLPQDTVLYYQFADCTDEG
SVSPLGRTRTLPSPDGNVNGGDPLTLAVYSCSQYQNGYFNAYGVGTYNTSADFFVHLGDY
IYESIGNGDKIGRAVTGRELATLADYRERLAQYRTDPSLVAAHQNHPWITVWDDHEIADN
AWKAGTADSNDSTVALGDNASGCTFSPSGACFTDRKLAGVRAYHEWLPVRQVTADDKLRI
WRGFQVGQLLDLIMLDTRQYDRDITDVYYNTDFVAGLANYANRSLMGAEQEQWFADSLSQ
SQNRGAVWKVVGQQIVFTQLDNEGSYNYDAWDGYTANRARILNHITKNGIDNTIVLSGDS
HANWVSDIAYPNDTSYDPVTGTGALGVEFAGTAVTSGSSFGSLAPAAADNRSAALVAANA
PLQWSEGYYRGFFALTISPEWMNATYYAMRNISYANFDAFASANFSVKAGENRLTRPVAG
GAVGAGALKLID
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggtttgggtctacgcgctactcggtgcgcataccgcgcttgcggcggcctcgctcctg
gatcgtaacatggtgtaccgctccccccttgtggacatacctaagggcgatccctacgac
acctccgtcctcctctggactcgtgcagcgccctcctcggactccgccacccagcccgac
cagagcgtccccatctgcgtctcgtacaccatttccgcttccccggacctctcttctccc
ctcgactccggctcggccttcactaactacgacgtcgacttcacagttaaggtcgaagcg
acgggcttgccgcaggacaccgtgctgtactatcagttcgctgactgtacggatgagggg
agcgtgagcccgttgggtagaacgaggacgttgccgagtccggatggtaacgtcaacggc
ggcgatcccttgaccctggccgtatattcatgctcccagtatcagaacggctacttcaat
gcttatggcgtcggcacctataacacaagcgccgacttcttcgtccatctgggagactac
atctacgaatccattggcaatggcgacaaaatcggtcgcgcggtcaccggccgcgaactt
gccaccctcgccgactaccgcgagcgcctcgcccagtaccgcaccgaccccagcctcgtc
gccgcgcaccagaatcacccctggatcaccgtctgggacgatcacgagatcgcggacaac
gcctggaaagccggcacggccgacagcaacgattccactgtcgctttgggcgataacgcg
tcggggtgtacgttctctccctctggcgcgtgctttacggaccggaagcttgctggggtg
agggcgtatcatgagtggctgccggtgaggcaggtaacggcggatgacaagttaaggatt
tggagggggttccaggttgggcaattgttagatttgatcatgttggatacgaggcagtat
gacagggacataacggatgtgtactacaatacggattttgtcgccggtctagcgaactac
gcgaacaggtcgctgatgggtgcagagcaagagcaatggttcgccgactctctttcgcag
tctcagaatcgaggagctgtgtggaaggtcgtcgggcaacagatcgtcttcacgcaactc
gacaatgaaggttcatacaactacgatgcttgggatggctacactgctaatcgcgcgcgc
atcttgaatcatatcacgaagaacggtatcgacaacaccatcgtgctttccggggacagc
cacgcaaattgggtgtccgatattgcttaccccaatgacaccagctacgatccagtgacg
gggactggcgccctaggcgtcgaattcgctggcactgctgtcacttctggatcatccttc
ggatctctcgcgcctgccgccgctgacaatcgctctgccgcccttgtcgcagccaatgct
cctctgcagtggagcgaggggtactatcgcggattcttcgcactgacgatctcgcctgag
tggatgaatgcgacgtactatgcgatgcggaatatcagctacgcgaacttcgatgctttt
gcgagcgcgaacttctcggtcaaggctggtgagaatagacttacacgaccggtggccgga
ggtgcagtgggagcgggcgcattgaagttgatcgactag

DBGET integrated database retrieval system