KEGG   Schizophyllum commune: SCHCODRAFT_81397Help
Entry
SCHCODRAFT_81397  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
scm  Schizophyllum commune
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1105 aa AA seqDB search
MDVLDEKTNGAPPMDVDNDIVSVRDEVAFAAKHLPDLGQDVKDFKAYHWPLKNWKKLDKK
ITSEEFECGGHSWRILLFPFGNSNAPPNDTVSVYLDYAEPKKAPEGWHACAQFALVISNI
HDPTIYTVSHAHHRFIAEECDWGFTRFSELRKLFNVQEGHSRPIIEEESAMVSVFVRVLE
DPTGVLWHNFVNYDSKKETGFVGLKNQGATCYMNSLLQSLYCTNYFRKAVYQIPTEEDHP
TESVALALQRVFYHLQTSDQPVGTTELTKSFGWKSLDSFLQHDVQEFNRVLQDKLESKMK
GTKAEGAIAKLFTGKMKSFIKCVNVDYESSRTEDFNDLQLNVKGMKNLYESFKDYIQVET
LDGENKYQAEGYGLQDAKKGITFLSFPPVLHLQLKRFEYDIQRDAMVKINDRHEFPFEID
LAPFLDESADKSQSWVYSLCGVLVHSGDLHGGHYFALIKPDKHTRWLKFDDDRVTPVTDK
EVLEENYGGEVMNGTTPAMQRNQVRTMKRFTNAYMLVYIRQAVVDEILAPFTEEDTPAHL
KRRLDEERMQIEAKKREREEQHLYLTAKVITDDTFAKHEGFDLATFDDKNWPPSDLPTFR
VLKQETYATFKERVAKHFGYPVDRIRLWVLVNRQNKTVRPDAIIPDNEPAWTVEIIRNQL
AARTTDLRLYLDVLPDPPKPEPAPQTTIMIFLKHFDTSRQTLYGAGKAHMLRTAKVADLV
PIINERMRWQPGTPLKLYEEIKPGMIELMKPRSTFTQSEIQDGDVICFQVDIPDNDRIRD
LESQGLYSNPMQYYDFLQNRVMIIFRPKYEEPDHDHPEFHLVFSKKQNYDVMSQKVGEHL
RHDPIKLRFTTTHPSNGSPKAILKRSLNQSISEIMQPSYVSSTTTVILYEKLDVSIVELE
TKRSLKIIWTGIHNKEEASFPFLLPKTSAVHELAEHLAKQVTLTPTGTGKIRIFEISKDY
KTQREFTGSEMIGNIPDPVELYAEEIPRDELEASEDDKVIGVFHFSKDLSRTHGVPFRFV
VKRGEKFADTKKRLQARIGVPDKEFAKYRFALIQASTFKQPSYIEDDDTIYDHQFAPEDV
LGLDHVDKTGRARAGMAEKAIVIKG
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atggacgttctcgacgagaagaccaacggcgcaccacctatggatgtcgacaacgatatc
gtctctgttcgggatgaggtcgctttcgccgcgaaacaccttcctgatctcggacaagat
gtcaaggacttcaaggcctatcattggccactcaagaactggaagaagctggacaagaag
ataaccagcgaggagttcgagtgcggcggccatagctggcgcatactcctctttcccttc
ggtaactccaatgcgccaccaaacgacaccgtctctgtttatctcgactatgctgagccg
aagaaggcgcccgaaggctggcacgcctgcgcacagttcgcgctcgtcatctccaatatt
cacgatccgacgatctacaccgtcagccacgcgcaccatcgattcatcgctgaggagtgc
gactggggattcacccgcttcagcgagctgcgcaaactcttcaatgtgcaagaaggccat
tcccgacccattattgaggaggaatctgcgatggtcagcgtcttcgtacgcgttctagaa
gatccgactggggtgctatggcacaattttgtgaactacgactccaagaaggagacgggc
tttgtcggcctgaagaaccagggtgcaacatgctacatgaactccctccttcagtcatta
tattgtaccaactacttcagaaaggctgtgtaccaaattcccacagaggaagatcacccg
accgaaagcgtcgccctggcattacaaagagtgttctaccacctacaaacgtccgatcaa
ccagtcggtacgacggaattgacgaagtcattcggctggaagtcgttagactccttccta
caacacgatgtccaggagttcaatcgagtacttcaggacaagctcgagtccaagatgaag
ggcaccaaagcggaaggcgccatcgcgaagctcttcaccgggaagatgaagagcttcatc
aagtgcgtgaacgtagactacgaatcctcacggacggaagatttcaacgatctccagctc
aacgtcaagggtatgaagaacttgtacgagtccttcaaggattacattcaagtcgagact
ctggatggcgagaacaaataccaggctgagggctacggcttgcaagacgccaagaagggc
atcactttcctctccttccctcctgtactccaccttcagctgaagcgctttgagtatgac
attcagcgcgacgctatggtcaagatcaacgatcgccatgaatttcccttcgagatcgac
ctcgcgccgttcttagacgagagcgcagacaagtcacaatcttgggtctactccctctgc
ggcgtcctggtgcactctggcgatcttcacggcggccactacttcgcgctcatcaagcct
gacaagcacacccgctggctgaaattcgatgacgaccgtgtcacgcctgtcaccgacaag
gaggtgcttgaagaaaactacggcggcgaggtcatgaacggcacaacgcccgccatgcag
cgcaaccaggtgcgcaccatgaagcgtttcacgaacgcgtacatgttggtgtacatccgc
caagccgtcgtggacgagattctcgctcctttcacggaggaagacacgcccgcccacctc
aagcgcagattggatgaggagcgtatgcagattgaggcgaagaaacgcgaacgggaagaa
caacatctctatctgacggccaaggtcattacggatgacacgttcgcgaagcacgagggc
tttgacctggcgaccttcgacgacaagaactggccgccatcggatctgcccactttccgg
gtcctgaagcaggaaacgtacgcgacgttcaaagaacgtgtcgcgaagcacttcgggtac
ccggtagaccgcatacgactatgggtcctcgtcaaccggcagaacaagaccgttcgccca
gacgccatcatccccgacaacgagcctgcatggacggtcgaaattatccgcaaccagctg
gctgcgcggacaacagacctccggctgtacctcgacgtcctccccgaccctcccaagccc
gaaccggcgccacaaacgaccatcatgatcttcctcaagcacttcgacacgtcgcggcaa
acgttgtacggtgccgggaaggcccacatgttgcgcacggcgaaggtagcggaccttgtc
cccattatcaacgagcggatgcgctggcaacccggcacgccgctcaagctatacgaggag
atcaagccggggatgatcgagctcatgaagccgcggtcgacgttcacgcagagcgagatc
caggacggcgacgtcatctgcttccaggtggacattcctgacaatgataggatccgcgat
ctggagagccaggggctgtattccaacccgatgcagtactatgacttcttgcaaaaccgc
gtgatgatcatcttcaggcccaagtacgaggagcctgaccatgaccatccggagttccac
ctcgtcttcagcaagaagcagaactacgatgtgatgtcgcagaaggtcggcgagcatttg
cgccatgaccccatcaagctccgcttcaccaccacccatccttcaaacggctcgccgaaa
gccatcttgaagcgctccctgaaccagagcatcagcgagatcatgcagccctcctacgtc
tcctccacaaccaccgtcatcctctacgagaagctggacgtctccatcgtcgagctcgag
acgaagcgaagtctcaagatcatctggaccggcatacacaacaaggaggaggcgtccttc
cccttcctgctgccaaagacgagcgcggtgcacgagcttgcagagcatctggcgaagcag
gtcacgctgacgccgaccgggacgggcaaaatccgcatcttcgagatctcgaaggactac
aagacgcaacgggagttcactgggtcggagatgattgggaacatcccggatccggtcgag
ttgtatgcggaggagatcccgagggacgagctcgaggcgagcgaggacgacaaggtcatt
ggcgtcttccacttctcgaaggacttgtcacggacacatggcgtgccgttccggtttgtg
gtcaagcggggcgagaagttcgcggataccaagaagcgcttgcaagcacgaataggtgtc
ccggataaggagttcgccaagtaccgcttcgcgctcatccaagcatcgacgttcaagcaa
ccatcatatatcgaggatgacgacacgatctacgaccaccagttcgcaccagaagacgtg
ctcggcttggaccacgtcgacaagaccgggcgcgcgcgagcaggcatggcggagaaggcg
attgtgatcaagggctga

DBGET integrated database retrieval system