KEGG   Schizophyllum commune: SCHCODRAFT_81545Help
Entry
SCHCODRAFT_81545  CDS       T01331                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
scm  Schizophyllum commune
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:scm00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 502 aa AA seqDB search
MARQNSSHSQSYTVVIKLGTSSIVHEETHQPLLSTLSSVVETVVKLRQDGHRVVLVSSGA
IGIGLKRMNMAQRSKSLSGKQALAAIGQGRLIALYDNLFGQVDQPIAQILLTRGDISDRT
RYLNAVNTLNELLLMGVLPIVNENDTISVSEIKFGDNDTLSAVTSSMIHADFLVLLTDVD
GLYTANPRKDPTAKQVEVVESVAAIRSQVSTNTLGSSLGTGGMETKLIAADIATAAGVTT
IITSSKNPMNIVDIINYHRASRRSARSGIATPLESPNPDEGVMTSAAAPTLASSSSATLN
AASSLPHRPPHTVFLPSASPIRDLKAWTRHTLFPAGSVVVDHGAHRVLSRRESGGRLLPA
GVLGVIGKFASGQAVRIVVPKVVEGASQGAAGGGAPNPMVSGLAKAVGVVEELQQEASAP
GSSASTRPGTPDGAAHPEPSKMPTREYTEDDVIEVGRGLANYNWEQVLRVKGLNSSQMPQ
VLVYVDSEYVVENITIRVPPST
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacaaaactcctcacactcgcaatcctacacggtggtgatcaaactcggaacg
tcgtccatcgtgcacgaggagacgcatcaaccgctgctctctacgctctcatctgtggtg
gagacggtggtcaagttgaggcaggatgggcatcgggtggtcctcgttagctctggcgct
attggcatcggcttgaagcggatgaatatggcgcagcggtcgaagagtctgtcggggaag
caggcgctagcggcgattggacagggccgtctcattgcgctttacgacaatctgtttggt
caggtcgaccagcccattgcgcagattctactgactcgaggagatatatctgatcgcaca
cgatatctcaacgccgtcaacacgttgaatgagctgttgctcatgggtgtgctgcccatc
gtgaatgagaacgacacgatttccgtctcggaaatcaaattcggcgacaacgacacgcta
tcagcggtcacatcgtccatgatccacgctgacttcctcgtcctcctgaccgacgttgac
ggcctttatactgccaacccgcgaaaagaccccactgcaaagcaagtcgaagtcgtagag
tctgtagccgcgattcgctcgcaagtatccacaaacaccctcggctccagcctcggcacc
ggaggcatggagaccaagctcatcgccgccgacatcgcgacagcagccggcgtcaccacc
atcatcacctcctccaagaacccgatgaacatcgtcgacatcatcaactaccaccgcgcc
tctcgacgctctgcgcgttcgggaattgctacgcctctcgagtccccgaaccccgacgag
ggggttatgacctctgctgctgctccgactctcgcatcgtcttcctctgccaccctgaac
gctgctagctctctccctcaccgcccgccacataccgtcttcctcccctctgcctccccc
atccgcgacctcaaggcctggacgcgccatacgctgttccccgcgggcagcgtcgtcgtc
gaccacggcgcccaccgcgtgctctcgcggcgcgagagtggggggaggctgctaccggcg
ggcgtgttgggcgtcatcggtaaatttgcttcggggcaggcggtgcggatcgtggtgccg
aaggtggtggagggtgcgagtcagggagcggcggggggtggtgcaccgaatccgatggta
tctggtttggcaaaggcagtgggagtggtggaggagctgcagcaggaggcgtcggcgccg
ggctcatccgcctcgacgaggccagggacgccggatggtgcggcacatccggaaccttcg
aagatgccaacgagagagtacacggaggacgatgtaatagaggtcgggaggggactcgca
aactacaactgggagcaggtcttgagagtcaaggggctgaatagctcgcagatgcctcaa
gtgctcgtatatgtggattcggagtatgtcgtggagaacatcaccatccgcgtaccgccg
tctacttaa

DBGET integrated database retrieval system